KEGG   Sorghum bicolor (sorghum): SORBI_01g008760Help
Entry
SORBI_01g008760   CDS       T01086                                 

Gene name
SORBIDRAFT_01g008760, Sb01g008760
Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SORBI_01g008760 (SORBIDRAFT_01g008760)
  Replication and repair
   03420 Nucleotide excision repair
    SORBI_01g008760 (SORBIDRAFT_01g008760)
Transcription machinery [BR:sbi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SORBI_01g008760 (SORBIDRAFT_01g008760)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 318 aa AA seqDB search
MADFRTSTQRERWIFQPHDLMERWAAANQRAVQTLAQYGTTRLSVDLLDGSVSYPEPAPD
HVEGSSGIKPLSYEEEQLTRVFYEQKIQEVCAAFKFPHKIQATAIIYFKRFYLQWSVMEH
HPKHIMLTCVYASCKVEENHVSAEELGKGIQQDHQIILNNEMILLKTLDFDLIVYAPYRS
IEGFIDDLEDFCRVGNGPFQRLKELRQAAVSHVDKMMLTDAPLLYTPGQLALAALHKSND
LLRVVNFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDLRHVDRKLKHCW
DPSSHDEHKKKEKKSNNS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttccggacctccacccaacgggagaggtggatcttccagccgcacgatctg
atggagaggtgggcggcggcaaaccagcgggctgttcagacccttgcgcagtatgggacg
acgcggcttagtgtggacctgcttgatggctcggtctcctacccagagcccgcaccggat
catgttgagggtagttcgggtataaaacctctgtcttacgaagaggagcaattgacacgg
gtattttacgagcagaaaattcaggaagtatgtgctgcattcaagttccctcacaaaatc
caggctacagcaataatatatttcaagagattctatttacaatggtctgtaatggagcat
cacccaaagcatatcatgttaacatgtgtatatgcttcttgcaaagtggaagaaaaccat
gtttctgctgaggaacttggtaaaggaattcagcaggaccaccagatcattctaaataat
gagatgattcttcttaaaactttagattttgacctcattgtttatgctccatatcgatcg
attgaaggatttattgatgacctagaggatttttgcagggtaggtaatggtccattccag
cgtttgaaggagttgcgccaagctgctgtatcccatgttgacaaaatgatgttgactgat
gcacctcttctctatactcctgggcagttggcactggctgcccttcacaagtccaatgat
cttctcagggtcgtcaattttgaaagatacttggaaactattttctcaaggcaacattct
gattgtccagtcgaacagtttgttcagtcaatcaacacaatcaattacttggttgaccag
cttaatatacctaccgttaaggacctgaggcacgttgaccgcaagctgaaacattgttgg
gatccaagctcacatgatgagcataagaagaaagaaaagaagtcaaacaacagctag

DBGET integrated database retrieval system