KEGG   Sorghum bicolor (sorghum): SORBI_01g008860Help
Entry
SORBI_01g008860   CDS       T01086                                 

Gene name
SORBIDRAFT_01g008860, Sb01g008860
Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 621 aa AA seqDB search
MFGRDPWGGPLEISNADSATDDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKKKKY
VDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKALMF
FNAQRSGPLPKHNGVSWRGNSCMKDGLSDSTVRRSLVGGYYDAGDAIKFNYPMAWSMTML
SWSVIEYRAKYEAIGELDHIKELIKWGTDYILKTFNSSADTIDRIVAQVGVGDTSKGGSQ
PNDHYCWMRPEDIDYKRPVTECHSCSDLASEMAAALAAASIVFKDSKTYSDKLVKGAKAL
YKFGRLQRGRYSPNGSDQAIFYNSTSYWDEFVWGGAWMYFATGNNSYLTVATAPGMAKHA
GAYWFGSPNYGVFTWDDKLPGAQVLLSRLRLFLSPGYPYEEILRTFHNQTDNVMCSYLPL
FNSFNFTKGGLIQLNHGRPQPLQYAVNAAFLASLYSDYLEAADTPGWYCGPNFYTTEVLR
KFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKA
NPNILVGAMVAGPDRHDGYKDVRTNYNYSEPTLAANAGLVAALISISDIKTGRFGIDKNT
IFSAIPPMFPTPPPPPSAWKP
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgttcgggagggacccctggggcgggccgctggagatctccaacgccgactcggcgacg
gatgacgaccggagccgggacctggacagggcggcgctgatgcggcagctggacgagacg
cagcagagctggctcctggcggggcccggcgaccaggccggcaagaagaagaagaagtac
gtcgacctgggatgcgtcgtcgtcgaccgcaagatcttcatgtggaccgtcggcaccatc
ctcggcctcggcgtcttcatcggattcatcatgatgatcgtcaagctcgtcccgcacaag
cggcccccgccgccgccccccgaccagtacacgcaggcgctgcacaaggcgctcatgttc
ttcaacgcgcagcgatccggtccgttgccaaagcacaatggcgtcagctggaggggcaat
tcctgcatgaaggatggcctctccgacagcaccgtccgccggagcttggttgggggctac
tacgatgcaggggacgccatcaagttcaactatcccatggcctggtccatgaccatgctc
agctggagtgtgatcgagtacagggctaagtatgaggccatcggtgagctcgaccatatc
aaggagctgatcaagtggggaacagactacatcctcaaaacattcaattcatctgccgac
acgatagacaggattgtcgctcaggtgggtgtaggtgacacctctaaaggtggcagtcag
cctaatgaccattactgctggatgagaccagaggacatcgattacaaaaggccagtcact
gagtgtcactcttgctcagatctagcatctgaaatggctgccgccctggctgcagcttcc
atagtgttcaaggacagcaaaacctactctgacaagctcgtcaaaggtgcaaaagctctg
tacaaatttggcaggctgcagcgcgggcgatacagccccaatggatccgatcaggcaatt
ttctacaattccaccagctactgggatgagtttgtgtggggtggtgcgtggatgtacttc
gccacagggaacaattcatatctcacagtcgccacagccccaggaatggcaaagcatgct
ggagcctattggtttggaagtccaaactatggagtatttacctgggatgacaaacttcca
ggagctcaggtccttctcagcaggctgcgactcttcctaagtccagggtacccttacgaa
gaaatactgaggacattccacaaccaaactgacaacgttatgtgctcgtatttacctcta
ttcaattcattcaacttcactaaaggaggattaatacaactcaaccatggaaggcctcaa
ccacttcagtatgctgtcaatgcagctttccttgcttctttatacagtgattatcttgaa
gctgcagacacgcctgggtggtactgtggacctaatttctacaccacagaagtcctccgc
aagtttgccaggtcacagcttgattacatccttggaaagaacccattaaagatgagctac
gttgtgggttttggaaacaagtacccgaagcgccctcatcacagaggtgcatcaatacct
cataatggcgtcaagtatggatgcaaaggaggttacaaatggagggatacaaaaaaggca
aaccctaatatccttgttggagcaatggtggctggccctgacaggcatgatggctacaaa
gatgtccgcacaaactacaattactcagagcctactcttgcagcaaatgctggtttggtt
gcagcactgatttctatatctgatatcaaaactggacggttcggcattgataagaacacc
atcttctctgcaattcctccaatgttcccaacacccccaccaccgccatcagcatggaaa
ccataa

DBGET integrated database retrieval system