KEGG   Sorghum bicolor (sorghum): SORBI_01g009270Help
Entry
SORBI_01g009270   CDS       T01086                                 

Gene name
SORBIDRAFT_01g009270, Sb01g009270
Definition
hypothetical protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SORBI_01g009270 (SORBIDRAFT_01g009270)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SORBI_01g009270 (SORBIDRAFT_01g009270)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 447 aa AA seqDB search
MDMRRRLSLARVPAVATMVVVMLLSLSSSLCVSAARAEQQRHPVVLIPGAGGNQLEARLT
EDYKPSSLVCRVWPLVRGRGGWFRLWFDPSVLVAPLTRCFAERMTLSYDADADDYRNAPG
VETRVSDFGSTSTLRYLDPNLKLLTGYMNTLASTLEEKAGYEEGRDLFGAPYDFRYGLAG
PGHPSQVGSAYLQRLRLLVESACAANGGRAAILVAHSLGGLFALQLLARSPAPWRAAHVQ
RLVTLSTPWGGSVQEMLTFASGNTLGVPFVNPSLIRDEQRSAESNLWLLPTPKVFGNTTL
VVSRSHNRSYSAKNMTQFLRDIGFEQGVEPYRARIRPLVEALPEPGVPLTCLVGTGVVTV
ESLVYGDGGFDEDPEEVVYGDGDGTVNLASLVGPIKAWSDSPTQVVEVVELPKVSHSGML
NDKSALEQIIRIVDSINFNTTSYHQSS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggacatgaggaggcgcctctcgctggcccgcgtgccagcggtggcgacgatggtggtg
gttatgctgctgtcgctgagctcgtccttgtgcgtgtcggcggcgagggcggagcagcag
cggcacccggtggtgctgatcccgggcgcgggcggcaaccagctggaggcgcggctgacg
gaggactacaagccgtccagcctcgtgtgccgggtgtggccactcgtgcgcggccgcggc
ggctggttccgcctctggttcgacccctccgtgctggtcgcgccgctcaccaggtgcttc
gccgagcggatgacgctctcctacgacgccgacgccgacgactaccgcaacgcgcccggc
gtcgagaccagggtctccgacttcggctccacctccaccctccgctacctcgaccccaac
ctcaagctcctgacggggtacatgaacactctggcgagcacgctggaggagaaggccggc
tacgaggagggccgcgacctgttcggcgcgccgtacgacttccggtacgggctggccggg
ccggggcacccgtcgcaggtgggcagcgcgtacctgcagcggctcaggctgctggtggag
tcggcgtgcgcggccaacggcgggcgggccgcgatcctggtggcgcacagcctgggcggc
ctgttcgcgctgcagctgctggcgcgcagcccggcgccgtggcgcgcggcgcacgtgcag
cgcctcgtcacgctctccacgccgtggggcgggtcggtgcaggagatgctcaccttcgcc
tccggcaacacgctcggggtgcccttcgtcaacccgtccctcatccgcgacgagcagcgg
tccgccgagagcaacctgtggctgctgccgacgcccaaggtgttcggcaacaccacgctg
gtggtgtcgcggagccacaaccggtcctactccgccaagaacatgacgcagttcctccgg
gacatcggattcgagcaaggcgtggagccgtaccgcgcgcggatacgaccgctcgtcgag
gccctgccggagcccggcgtgcccctgacgtgcctcgtgggcaccggcgtcgtcacggtg
gagagcctcgtgtacggcgacggcggcttcgacgaggaccccgaggaggtggtctacggc
gacggggacgggacggtgaacctggccagcctcgtgggcccgatcaaggcctggtctgac
tcgcccacgcaggtcgtcgaggtggtggagctgcccaaggtgtcgcactccggcatgctc
aacgacaagagcgcgctggagcagatcatcaggatcgtcgattctataaacttcaacacc
acgagctatcatcagtcctcttag

DBGET integrated database retrieval system