KEGG   Sorghum bicolor (sorghum): SORBI_01g010730Help
Entry
SORBI_01g010730   CDS       T01086                                 

Gene name
SORBIDRAFT_01g010730, Sb01g010730
Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SORBI_01g010730 (SORBIDRAFT_01g010730)
Protein kinases [BR:sbi01001]
 Serine/threonine protein kinases: Other group
  TTK family
   SORBI_01g010730 (SORBIDRAFT_01g010730)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 759 aa AA seqDB search
MENRDSFPRPPAPSYAPATRAVKGIAVPAGGDTAATKLTSSSGSSSSLTLSPPRFMQELH
AAVKRQRPFGPMQSKLPRATRVLVSGGECGNKVGASASVAKHPEQKVTQTQRGLLVPSRL
PNATPDQSTPKLGSSTPDELMLTSSSSVLKGTIDTHAQSVGQKNNEANLLIDTEKSALEA
LPSQTTSCNALIGESFKKGQLDLDGNPQLTSQSDNIGITVDSRMDSMLSYLHDVSLTAGD
NFPANQGAQYDHQQNHQELEIVGAPNLSRRGIDEARNHNHGEPMTRFSAIGSSVTAISLH
SGPTVQSSQTPQVSRYTSPVQMPESAVESSKGVLGHGSQKEHGGATGVGDWNPHNQQVQN
LGNGATDKAVSSIGRLRSEGLLANDQSTSARDGGASQPNKGQKERHKKNYDPNVFFKVNG
KLYQKLGKIGSGGSSEVHKVISSDCIIYALKKIKLRGRDYPTAYGFCQEIEYLNKLKGKS
NIIQMIDYEVTDKSLLLESSVPPRDGRIKDDHFIYMVLEYGEIDLANMVALKWKERHNCN
MKIDENWLRFYWQQMLEAVSTIHEERIVHSDLKPANFMLVRGSLKLIDFGIAKAIMNDTT
NIQRDAQVGTLNYMSPEAFMCNDTDSGGNVIKCGRPSDIWSLGCILYQMVYGKTPFADYK
TFWAKYKEVTDRNHKIMYEPVDNPWLIDLMQRCLAWDRNERWRIPQLLKHPFLNPPVPKD
LPPSDNDPCRLLMERIRVHWDNPVVQKFHSLIQELDGDQ
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagggatagcttccctcggcccccagcgccctcctacgcccccgcaaccaga
gccgttaagggcatcgcggtccctgccggcggggacacggccgccaccaagctgacgtcg
tcgtcggggtcgtcctcgtccctcacgctctcccctccccgcttcatgcaagagcttcat
gcggctgtcaagcggcagaggcctttcggtccaatgcagtctaaacttccaagagcaaca
cgggtcctggtttccggaggtgagtgtggaaataaagttggtgccagcgcttctgttgcg
aaacaccctgaacaaaaagttacgcagactcagagaggcctattggtaccctctaggttg
ccaaatgcgacgcctgatcaaagcactcctaaattagggtcctctaccccagatgagttg
atgttgacatcttcctcgtcagtgttgaaaggcaccattgatacccatgcacaaagtgtt
ggccagaagaataatgaggctaatctgttgattgatacggagaagtcagctctggaagct
ttgccatctcaaactacgtcatgcaatgcattgattggggaaagtttcaagaaaggacag
cttgatttggatggtaatccacagttgacgtcacaaagtgataatataggcatcactgtt
gatagtagaatggacagtatgttgtcttatctacatgatgtttcattgacggcaggagac
aattttcctgcaaatcaaggagctcagtacgatcaccagcagaaccatcaggagcttgaa
attgttggtgcgcctaatttgtctcggagagggatcgatgaggctcgtaatcacaatcat
ggagagccaatgactcgtttctctgccattgggtcatctgtcactgccatttctctacac
tcagggcctactgtccaaagttcacaaactccgcaggttagcagatacacttcaccagtg
cagatgccagaatctgctgtagaatcatccaagggtgtactgggccatggttctcaaaag
gagcacggtggtgcaactggtgtcggtgattggaatccccacaaccagcaggttcaaaat
ctaggcaatggtgccacggacaaagctgtttccagcattggcagattgcgttccgaagga
ttacttgcaaatgatcagtctacatctgccagggatggtggtgcttcccaaccaaacaag
ggtcagaaggagcgccacaaaaagaattatgatcctaatgttttctttaaggtgaatggg
aaactttatcagaaacttggtaaaataggatctggaggtagcagtgaagttcataaagtc
atatcatcagattgcataatatatgccttgaaaaagatcaagcttagaggccgtgactac
cctactgcatatgggttttgtcaagaaattgagtacttaaataagttgaaaggaaagagc
aatatcattcagatgattgattacgaggtcactgataagagtttacttctagaaagttct
gtgccacccagggatggaagaattaaggatgatcactttatttatatggtcctggagtat
ggtgaaatcgacttggctaacatggttgctctgaagtggaaagagagacacaactgtaat
atgaaaattgatgaaaattggctacgcttttattggcagcaaatgcttgaagctgtcagt
acaatacatgaggaacgaatagtccactcggatttgaagcctgcaaactttatgcttgtg
aggggctctcttaaactaatcgactttggcattgccaaggctataatgaatgatacaaca
aatattcaacgtgatgctcaggtagggactctgaactacatgtcacctgaagcattcatg
tgcaatgatacggactcgggtggtaatgttatcaagtgcgggcgcccctctgatatttgg
tctcttggctgtatactttaccagatggtgtatggtaagacaccatttgcagactacaag
actttctgggccaaatataaagaagtcactgataggaaccacaagatcatgtatgaacca
gttgacaacccatggctaattgatttgatgcaaaggtgtctcgcctgggaccgaaatgaa
cgatggaggatacctcaacttctcaagcacccattcctcaatccgccagttccaaaggat
ctaccgccctctgacaatgatccatgtaggttgctcatggagaggatcagagtccactgg
gataatccggtggttcaaaaattccatagtttaattcaagaactcgatggggatcagtag

DBGET integrated database retrieval system