KEGG   Sorghum bicolor (sorghum): SORBI_01g016500Help
Entry
SORBI_01g016500   CDS       T01086                                 

Gene name
SORBIDRAFT_01g016500, Sb01g016500
Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbi00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 450 aa AA seqDB search
MEQLVGVHHHHHHHHHHSLSPRAPRTPTRPQPQPHPLLHHLPPSNNRLRDLHSQIRIHPA
VPAAASRVIRATPPFFLVLLAAVYLLASVTIFSAPTPLLRLRLASPRPLLLPMPAPPPPE
LFDLDGGSVRVRLTNVGAAVTSLLVPDKNGVLADVVLGFDSLDPYLNGTSPYFGCIVGRV
ANRIKDGKFTLNGVQYNLSINNPPNTLHGGFKGFDKTVWEVAEYNKGDKPSITFKYYSKD
GEEGYPGDVSVTVRYSLLPSATLKLEMEAIPLNKATPISLAQHTYWNLAGHDSGDVLSHS
IQIWGSQITPVDQTSIPTGEFMPVSGTPFDFLTGNRIGSRIDQVPGGYDHNYMLDSSEVR
SGLRHVAKVSDPSSLRALDIWADAPGVQFYTGNFLHGIVGKGGAVYGKHSGLCLETQGFP
NAVNQPNFPSVVFHPGEKYRHTMLFEFSTM
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctggtgggagttcaccaccaccatcaccaccaccaccaccactcgctctcc
cctcgggctcctcgcaccccgacccgcccgcagccgcagccgcacccgctcctccaccac
ctccccccgtccaacaacaggctccgggatctccactcccagattcgcatccaccccgcg
gtccccgcggccgccagcagggtcatccgcgccaccccgcccttcttcctcgtcctcctc
gccgccgtctacctcctcgcctccgtcaccatcttctccgcccccacgccgctgctccgc
ctccgcctcgcctcgcccaggccgctgctcctcccgatgcccgcgccgccgccgccggag
ctctttgatctggacggcgggagcgtgcgggtccgcctcaccaatgtcggcgccgccgtc
acctcgctcctcgtcccggacaagaacggggttctcgctgatgtggtgctcggattcgac
tcgctggatccgtacctgaatggaacctcaccttacttcggctgcattgttggtcgagtt
gcaaatagaatcaaggatggaaagttcactctaaatggggtgcagtacaatctgagtatc
aacaacccacctaacactcttcatggtggatttaaagggtttgacaaaactgtatgggaa
gtcgctgaatataacaaaggggacaagccttcaattaccttcaagtattatagtaaagat
ggagaggaaggttacccaggcgatgtttctgttactgtcagatattcacttcttccaagt
gcaacactgaagcttgagatggaagccataccattgaacaaggccacacccatcagttta
gcacagcacacctattggaacctggcaggccacgactcaggagatgtgctttcacattcg
atccagatatggggctctcagataactccagtagatcaaacctcaatacctacaggcgag
ttcatgccagtaagtggcactccctttgattttctgactgggaataggattggaagcaga
attgatcaggtccctggtggttatgatcataattacatgcttgactccagtgaagtgagg
tcaggtttgcgacacgtggcaaaagtgtcagacccatctagtttgagggccctagacatt
tgggctgatgcacctggagtgcagttctacactggaaatttccttcatggtattgtgggc
aaaggaggtgcggtctatggaaagcattctggcctctgcctcgagactcaaggtttccca
aatgctgttaatcaacctaattttccctcagttgtctttcaccctggtgagaagtacagg
catacgatgctgtttgagttctctactatgtag

DBGET integrated database retrieval system