KEGG   Sorghum bicolor (sorghum): SORBI_01g019730Help
Entry
SORBI_01g019730   CDS       T01086                                 

Gene name
SORBIDRAFT_01g019730, Sb01g019730
Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:sbi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 210 aa AA seqDB search
MAEVEVPAAAVATTIPEAAEATEGGAAAEAKGPHKLHRQWTFWYDIQSKPKPGAAWGTSL
KKAYTFDTVEEFWSLYDQIFRPSKLSGNADFHLFKAGVEPKWEDPECANGGKWTVPCNRK
ATFENMWLETLMALIGEQFDETEDICGIVASVRARGDKLALWTRTASNEAVQVNIGKKWK
DVIDYNDKITYTFHDDSRREKPSRGGRYTV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtcgaggttccagctgctgcggtcgcgacgacgatccctgaggcggcggag
gctaccgagggcggagccgctgcggaggcgaagggtccgcacaagctgcacaggcagtgg
accttctggtacgacatccagtcgaagcccaagcccggcgctgcgtggggcacctccctc
aaaaaggcctacaccttcgacaccgtcgaggagttttggagcttgtatgatcagattttt
cgtccaagcaagttgtctgggaatgctgattttcatctgttcaaggctggagtagagcca
aaatgggaagacccagagtgtgcaaatggtggcaaatggactgtcccatgcaacagaaag
gcaacctttgagaacatgtggcttgaaacgttgatggctcttattggggagcagtttgat
gaaacagaggacatttgtggaattgttgctagtgtccgtgcaagaggagataagctcgca
ttatggactaggactgccagcaacgaagctgtccaggtgaacattggcaagaaatggaag
gatgtcatcgactacaatgacaagatcacctacactttccatgacgactccagaagagag
aagccgagcaggggcggacggtacaccgtgtaa

DBGET integrated database retrieval system