KEGG   Sorghum bicolor (sorghum): SORBI_01g019730Help
Entry
SORBI_01g019730   CDS       T01086                                 

Gene name
SORBIDRAFT_01g019730, Sb01g019730
Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SORBI_01g019730 (SORBIDRAFT_01g019730)
Messenger RNA biogenesis [BR:sbi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     SORBI_01g019730 (SORBIDRAFT_01g019730)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SORBI_01g019730 (SORBIDRAFT_01g019730)
Translation factors [BR:sbi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SORBI_01g019730 (SORBIDRAFT_01g019730)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 210 aa AA seqDB search
MAEVEVPAAAVATTIPEAAEATEGGAAAEAKGPHKLHRQWTFWYDIQSKPKPGAAWGTSL
KKAYTFDTVEEFWSLYDQIFRPSKLSGNADFHLFKAGVEPKWEDPECANGGKWTVPCNRK
ATFENMWLETLMALIGEQFDETEDICGIVASVRARGDKLALWTRTASNEAVQVNIGKKWK
DVIDYNDKITYTFHDDSRREKPSRGGRYTV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtcgaggttccagctgctgcggtcgcgacgacgatccctgaggcggcggag
gctaccgagggcggagccgctgcggaggcgaagggtccgcacaagctgcacaggcagtgg
accttctggtacgacatccagtcgaagcccaagcccggcgctgcgtggggcacctccctc
aaaaaggcctacaccttcgacaccgtcgaggagttttggagcttgtatgatcagattttt
cgtccaagcaagttgtctgggaatgctgattttcatctgttcaaggctggagtagagcca
aaatgggaagacccagagtgtgcaaatggtggcaaatggactgtcccatgcaacagaaag
gcaacctttgagaacatgtggcttgaaacgttgatggctcttattggggagcagtttgat
gaaacagaggacatttgtggaattgttgctagtgtccgtgcaagaggagataagctcgca
ttatggactaggactgccagcaacgaagctgtccaggtgaacattggcaagaaatggaag
gatgtcatcgactacaatgacaagatcacctacactttccatgacgactccagaagagag
aagccgagcaggggcggacggtacaccgtgtaa

DBGET integrated database retrieval system