KEGG   Sorghum bicolor (sorghum): SORBI_01g021950Help
Entry
SORBI_01g021950   CDS       T01086                                 

Gene name
SORBIDRAFT_01g021950, Sb01g021950
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SORBI_01g021950 (SORBIDRAFT_01g021950)
Transcription machinery [BR:sbi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SORBI_01g021950 (SORBIDRAFT_01g021950)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 515 aa AA seqDB search
MDGLAAPSPSHSGATSGGGASHRKRKLPPSSLSDATADEDDDTTAPSSPSTAPSSPSRPS
SPSSSHSDDDEDDSLHTFNAARLDGAPGGGSASGRPPKPDSSSVSAASAAAAAAAGGGPK
LEPGSATAGDGKEDPKGLFTDNLQTSGAYSAREEGLKREEDSGRLKFLCYSNDGVDEHMI
WLVGLKNIFARQLPNMPKEYIVRLVMDRTHKSMMVIRNNIVVGGITYRPYASQRFGEIAF
CAITADEQVKGYGTRLMNHLKQHARDADGLTHFLTYADNNAVGYFVKQGFTKEITLDKER
WQGYIKDYDGGILMQCKIDPKLPYVDLATMIRRQRQAIDEKIRDLSNCHIVYPGIDFQKK
EAGIPRRLIKPEDIPGLREAGWTPDQWGHSKSRSAFSPDYNTYRQQLANLMRTLLKNLSE
HPDAWPFKEPVDSRDVPDYYDIIKDPIDLKTMLRRVDSEQYYVTLEMFVADMKRMFSNAR
TYNSPDTIYYKCATRLENFFSTKIASLVSQASTKS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggacggcctcgcggcaccgtcgccgtcccactccggcgccacctccggcggcggggcc
tcccaccgcaagcggaagctcccgccgtcgtcgctttccgacgccaccgccgacgaggac
gacgacaccaccgctccgtcatccccctccacggccccatcctcgccctcccgcccttcc
tctccatcttcctcacactccgacgatgacgaggacgactcgctccacacgttcaatgcc
gcgcgccttgacggcgcgccgggtgggggctccgcctccggccgtcctccgaagccggat
tcctcatcagtgtctgctgcgtcggccgccgccgcggctgcggcgggcggaggacccaag
ctggagcctggctcggcgaccgccggcgacgggaaggaggacccgaagggattgttcacg
gacaacctccagaccagcggcgcttacagcgcccgtgaggagggcctcaaacgcgaggaa
gattcgggaaggctgaaatttctctgttattctaacgatggtgttgatgaacacatgata
tggttagtaggtttgaagaatatcttcgctcggcagcttccaaatatgcccaaagaatat
attgtgcgccttgtcatggatagaactcacaagtcaatgatggttatcaggaacaatatt
gtcgtgggaggcattacttatcgcccttatgcaagccagaggtttggagaaatagcgttt
tgtgctatcacagctgatgagcaagttaaaggctatggaacaagattaatgaatcatttg
aagcaacatgcacgggatgctgatgggctcacacatttcttaacctatgctgataataat
gctgttggctattttgtaaagcagggtttcacaaaggagatcacattggacaaagaaaga
tggcaagggtacattaaagactatgacggaggaatattgatgcagtgtaaaattgaccca
aagctgccatatgttgatctggcaacaatgattcgacgtcaaaggcaggccattgatgag
aagatcagagacctttctaactgccatattgtttatcccggaattgatttccagaagaaa
gaagctggcattccaagaagactgataaagccagaagatatccctggtcttagggaagct
gggtggacgcctgatcagtggggtcactctaaatcacgatcagcgttctccccggactat
aatacttacagacaacaacttgctaaccttatgcggacattgttgaagaatctgagtgaa
catcctgatgcttggccatttaaagagcctgtggattcacgagatgttccagactattat
gatatcataaaagatcctattgatttaaagacgatgttaagaagagttgactctgagcaa
tattatgtgaccctagagatgtttgtagccgacatgaagagaatgttcagcaatgcaaga
acttacaattctccagatactatctattacaaatgcgcaacacggcttgaaaatttcttc
tcaaccaaaattgcttcactggtttcacaagcctcaaccaagagctag

DBGET integrated database retrieval system