KEGG   Sorghum bicolor (sorghum): SORBI_01g022370Help
Entry
SORBI_01g022370   CDS       T01086                                 

Gene name
SORBIDRAFT_01g022370, Sb01g022370
Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_01g022370 (SORBIDRAFT_01g022370)
   01230 Biosynthesis of amino acids
    SORBI_01g022370 (SORBIDRAFT_01g022370)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_01g022370 (SORBIDRAFT_01g022370)
   00030 Pentose phosphate pathway
    SORBI_01g022370 (SORBIDRAFT_01g022370)
   00051 Fructose and mannose metabolism
    SORBI_01g022370 (SORBIDRAFT_01g022370)
   00052 Galactose metabolism
    SORBI_01g022370 (SORBIDRAFT_01g022370)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SORBI_01g022370 (SORBIDRAFT_01g022370)
Protein phosphatases and associated proteins [BR:sbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SORBI_01g022370 (SORBIDRAFT_01g022370)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 524 aa AA seqDB search
MALAPMDYAGSISSGQKYLGRFGVPTSSRLRWVGYDTKSRTYQLVARAISVDQPQLDFSN
PDWKKQFQEDFNKRFSLPHLRDVIDVEPRPTTFSLKSRTPLENVNGTMQESWNGYVNDDD
RALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQYVKAGIVSCGGLCPG
LNDVIRQIVLTLEKYGVKNIVGIQHGFRGFFEDHLSEVPLSRHVVQNINLAGGSFLGVSR
GGANISDIVDSIQARRLDMLFVLGGNGTHAGANAIHDECRKRKLQVSIVCVPKTIDNDIL
LMDKTFGFDTAVEAAQRAINSAYIEAHSAFHGIGLVKLMGRSSGFITMQASLSSGQVDIC
LIPEVPFTLDGPNGVLRHLEHLIETKGFALVCVAEGAGQEYFQKSNATDASGNMVLSDIG
VHLQQKIKSHFKDIGVHSDIKYIDPTYMLRAVRANASDAILCTVLGQNAVHGAFAGFSGI
TTGVCNTHNVYLPIPEVIKSTRFVDPNSRMWHRCLTSTGQPDFH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcactagcgcccatggactacgctggttctattagttcaggccagaagtacctgggc
cgtttcggagtacccaccagcagtagattgcgatgggtgggatatgacacgaaatcaagg
acatatcagttggttgctagagccatatccgtggatcaaccgcaactagacttctcgaat
ccagattggaagaagcagtttcaagaggatttcaataagcgcttcagcttgccacacttg
agagatgtaattgatgtggaaccgaggccaactacattttctctcaagagcaggaccccc
cttgagaatgtgaatggtaccatgcaagaatcatggaacggctatgtgaatgatgatgac
agagcacttttgaaggttattaagtttgcctcaccaacttctgctggagctgactgcatt
gaccctgattgtagctgggttgagcaatgggtgcaccgtgctggtccacgcaaacaaata
tattttgagcctcaatatgtgaaggctgggattgtatcgtgtggtgggctctgccctggt
ctcaatgatgtcattcggcagattgtgcttacacttgaaaaatatggggtgaaaaacatt
gttgggatacagcatgggttccgtggattttttgaggatcacttatcagaagtgccactt
tctaggcatgtagtccaaaatatcaatcttgctggtggtagcttcttaggagtctcccgc
ggtggtgcaaacatttcagacattgttgacagtattcaggctaggaggcttgatatgctc
tttgtacttggtggaaatggaacacatgctggagctaatgctatacatgatgagtgccgc
aagagaaaactgcaggtatcgattgtatgtgtccccaaaactattgacaatgacatacta
ctgatggacaagacctttggatttgatactgcagtggaagctgcacaaagagctatcaac
tctgcatacattgaggcacattctgcatttcatggcattggattggtcaagctgatggga
agaagcagcggcttcatcacaatgcaggcctccctgtcaagtggccaagtagatatctgt
ctgatacctgaggtaccattcactcttgatggaccaaacggagttcttcgacatctcgag
cacttgatagagaccaagggatttgctctggtttgtgttgctgaaggagcaggacaggaa
tattttcaaaagtcaaatgcaactgacgcatcagggaacatggttcttagtgacattggt
gtccaccttcagcagaagatcaagtcccatttcaaggatataggagtccattctgatatc
aagtatattgatcccacgtacatgctccgcgctgtgcgggccaatgcatctgatgccatc
ctgtgcaccgtgcttggtcagaatgctgttcacggcgcctttgcgggttttagcggcatc
acaaccggggtgtgcaacacacacaatgtttacttgccgataccagaagtcatcaaatcc
acgaggtttgtcgatccaaacagtcggatgtggcaccggtgcctgacctcaactgggcag
ccagacttccattga

DBGET integrated database retrieval system