KEGG   Sorghum bicolor (sorghum): SORBI_01g025580Help
Entry
SORBI_01g025580   CDS       T01086                                 

Gene name
SORBIDRAFT_01g025580, Sb01g025580
Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sbi01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbi00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sbi00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sbi00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 394 aa AA seqDB search
MTNGNGGVAGGTRGKPIKCNAAVAWGPGVPLSVEEVEVAPPGPLEVRVKVLFTSICHTDL
SAWKGENEMHRKYPRILGHEAAGVVESVGEGVDGLAPGDHVIPIFTGECEKCVYCKSDKT
NLCGTYRVDPFKTTMVFDNGTRFSLVDRNSGLRQPVYHFLNTSTFTEYTVLDAACAVKIN
PKAPLHKMCLLSCGISTGVGAAWNSADVSAGSTVAVFGLGAVGLAVAEGARLRGAARIIG
VDVNPAKFSKGKEMGVTDFVDSRTCDKPVHEVISEMADGGVDYSFECTGISDVLREAFLS
THDGWGLTVMLGIHSTPKMVPLHPMELYGRRIIGCVFGDFKGKSQLPNLVDKCVSGEVNI
NFDGFITHKMPFSDINKAFQLLEEGKSLRCLLNL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgggaacggcggcgtcgccggcggcacccgtgggaagcccatcaaatgcaac
gcggcggtggcgtggggtcccggagtgccgctgtcggtggaggaggtggaggtggcgccg
cctgggcctctggaggtccgcgtcaaggtgctcttcacctccatctgccacactgatctc
agcgcctggaagggagagaacgagatgcaccgcaagtaccctcgcatcttgggccatgag
gcagccggagtggtggagagtgtgggcgaaggagtagacggtttggcccctggagaccac
gtaattcccatcttcaccggggagtgcgaaaaatgcgtgtattgcaagtcggacaagaca
aacctctgtggaacctaccgtgtagatcctttcaagaccaccatggtctttgacaatggc
acgaggttctccctggtggaccgcaactctgggttgcggcagccggtgtaccacttcctc
aacacctccaccttcaccgagtacaccgtgcttgacgccgcctgcgccgtcaagatcaac
cccaaggccccgctccacaagatgtgcctcctcagctgcggcatctccacaggagtggga
gctgcgtggaacagtgcagacgtttctgctggatcaacagttgcagtatttggacttggc
gctgttggtcttgctgttgctgagggtgccaggctgcgaggggcagctcggatcatcggc
gtggatgtaaaccctgcaaagttcagcaaaggtaaagagatgggtgtcaccgacttcgtg
gactctaggacctgtgacaaaccagtccatgaggtgatcagcgagatggcggatggaggt
gtagactacagctttgagtgtaccgggatcagtgatgtgctgcgtgaggccttcctgtcc
acgcatgatggttggggcctgacggtgatgctagggatccattcaacgcccaagatggtg
ccgctgcacccgatggagctctacggccgtcggatcatcggctgtgtcttcggcgacttc
aagggcaagtctcaactgcccaacctcgtcgacaagtgcgtcagcggggaggtcaatata
aacttcgatggcttcataacgcacaagatgccattctcggacatcaacaaagctttccag
ttactggaggaaggcaagtcgttgaggtgcctgctcaatctctga

DBGET integrated database retrieval system