KEGG   Sorghum bicolor (sorghum): SORBI_01g025580Help
Entry
SORBI_01g025580   CDS       T01086                                 

Gene name
SORBIDRAFT_01g025580, Sb01g025580
Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SORBI_01g025580 (SORBIDRAFT_01g025580)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_01g025580 (SORBIDRAFT_01g025580)
  Lipid metabolism
   00071 Fatty acid degradation
    SORBI_01g025580 (SORBIDRAFT_01g025580)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SORBI_01g025580 (SORBIDRAFT_01g025580)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SORBI_01g025580 (SORBIDRAFT_01g025580)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 394 aa AA seqDB search
MTNGNGGVAGGTRGKPIKCNAAVAWGPGVPLSVEEVEVAPPGPLEVRVKVLFTSICHTDL
SAWKGENEMHRKYPRILGHEAAGVVESVGEGVDGLAPGDHVIPIFTGECEKCVYCKSDKT
NLCGTYRVDPFKTTMVFDNGTRFSLVDRNSGLRQPVYHFLNTSTFTEYTVLDAACAVKIN
PKAPLHKMCLLSCGISTGVGAAWNSADVSAGSTVAVFGLGAVGLAVAEGARLRGAARIIG
VDVNPAKFSKGKEMGVTDFVDSRTCDKPVHEVISEMADGGVDYSFECTGISDVLREAFLS
THDGWGLTVMLGIHSTPKMVPLHPMELYGRRIIGCVFGDFKGKSQLPNLVDKCVSGEVNI
NFDGFITHKMPFSDINKAFQLLEEGKSLRCLLNL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgggaacggcggcgtcgccggcggcacccgtgggaagcccatcaaatgcaac
gcggcggtggcgtggggtcccggagtgccgctgtcggtggaggaggtggaggtggcgccg
cctgggcctctggaggtccgcgtcaaggtgctcttcacctccatctgccacactgatctc
agcgcctggaagggagagaacgagatgcaccgcaagtaccctcgcatcttgggccatgag
gcagccggagtggtggagagtgtgggcgaaggagtagacggtttggcccctggagaccac
gtaattcccatcttcaccggggagtgcgaaaaatgcgtgtattgcaagtcggacaagaca
aacctctgtggaacctaccgtgtagatcctttcaagaccaccatggtctttgacaatggc
acgaggttctccctggtggaccgcaactctgggttgcggcagccggtgtaccacttcctc
aacacctccaccttcaccgagtacaccgtgcttgacgccgcctgcgccgtcaagatcaac
cccaaggccccgctccacaagatgtgcctcctcagctgcggcatctccacaggagtggga
gctgcgtggaacagtgcagacgtttctgctggatcaacagttgcagtatttggacttggc
gctgttggtcttgctgttgctgagggtgccaggctgcgaggggcagctcggatcatcggc
gtggatgtaaaccctgcaaagttcagcaaaggtaaagagatgggtgtcaccgacttcgtg
gactctaggacctgtgacaaaccagtccatgaggtgatcagcgagatggcggatggaggt
gtagactacagctttgagtgtaccgggatcagtgatgtgctgcgtgaggccttcctgtcc
acgcatgatggttggggcctgacggtgatgctagggatccattcaacgcccaagatggtg
ccgctgcacccgatggagctctacggccgtcggatcatcggctgtgtcttcggcgacttc
aagggcaagtctcaactgcccaacctcgtcgacaagtgcgtcagcggggaggtcaatata
aacttcgatggcttcataacgcacaagatgccattctcggacatcaacaaagctttccag
ttactggaggaaggcaagtcgttgaggtgcctgctcaatctctga

DBGET integrated database retrieval system