KEGG   Sorghum bicolor (sorghum): SORBI_01g028410Help
Entry
SORBI_01g028410   CDS       T01086                                 

Gene name
SORBIDRAFT_01g028410, Sb01g028410
Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sbi01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sbi00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:sbi00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sbi00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 386 aa AA seqDB search
MASMPPPSAAGADSDQILVEVNGFTRTLILNRPKQLNALSSTMIMGLLRCFTAYEKDDGV
KLLIMKGKGRAFCAGGDVAGVVRSIHKDSWKYGADFFRNEFLLNYIIATYTKPQVSLLTG
IVMGGGAGVSLHGRFRVATDNTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVALAGAR
LDGVEMLACGLATHFVHSNRLLLLEESLKKVDTSNTFAVCGIIDQFAQQPSLKESSSLNR
LEIINKCFSKRTVEEIISALELEATNLADEWVATTIQSLKKASPTSLKISLRSIREGRTQ
TVGECLQREYRMVCHVMRGDFSRDFFEGCRAILIDKDRNPKWMPPRLEQVHDEAVEQYFS
RIDDPQWEDLNLPPRRSHGRNIESKL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgatgcctcccccaagcgctgcgggcgccgactctgatcagattttggtagaa
gtgaatggctttacaaggacactgattttgaataggccaaagcagctaaatgcgctctcc
tcaaccatgattatgggactcttgaggtgtttcactgcttacgagaaagatgatggagtt
aaattgttgattatgaagggtaaaggaagagcattttgtgctggaggtgatgttgctgga
gttgtccgatctatacataaagacagctggaaatatggtgctgatttcttccgaaatgaa
tttttgttgaattacataattgcaacttataccaaacctcaggtttctcttcttactgga
atcgtcatgggtggaggtgctggtgtttctttacatggaaggtttcgagttgccactgat
aacacggtttttgcaatgccagaaacagctctcggtctctttccagatataggggcctca
tattttctgtcccggcttcctggattctatggagagtatgttgctctcgctggcgccaga
ttggatggtgtggaaatgcttgcatgtggtctggcaactcattttgtccattcaaatagg
ctgctattgttggaagaatcacttaaaaaggtggatacttccaacacctttgctgtgtgt
ggtatcatcgatcaatttgctcaacagccatcactgaaagaaagcagctcattgaatagg
ttggaaatcatcaacaaatgcttttccaaaaggacagttgaagaaattatatccgctctt
gaactagaggccacaaatttggcagatgaatgggttgccacgacaatccagtccttgaaa
aaggcttcacctaccagtctgaaaatctctctgagatcgataagagaagggaggacacaa
actgttggggagtgcttgcagcgggaatatagaatggtttgccatgtcatgcgtggtgac
ttcagcagagacttctttgagggatgcagggcaatattgatagataaagatcgaaaccca
aagtggatgcctccaaggttggaacaagtgcatgacgaggctgttgaacaatatttctcc
agaattgatgatccacagtgggaagatttgaacctaccacccagacgttcccatggaaga
aacatcgagtccaagctttga

DBGET integrated database retrieval system