KEGG   Sorghum bicolor (sorghum): SORBI_01g028520Help
Entry
SORBI_01g028520   CDS       T01086                                 

Gene name
SORBIDRAFT_01g028520, Sb01g028520
Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:sbi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 720 aa AA seqDB search
MALAISMEGIDARARELGVDLSAVDLDSITLPAGEDFGILSDDEEVLRSEDPPELEMGLS
NIIVVDNLPVVPPEKFEKLENVIRKIYSQIGVIKENGLWMPVNSETKKTYGYCFIEYNTP
QEAELAREKTNGYKLDKSHIFAVNLLDDFEKYMKVPDTWTPAEIKPYTAGENLLKWLTDE
KARDQFVIRAGTLTEVYWNDARKLAPELVFQKQYWTDSFIQWSPLGTYLATVHRQGSQVW
GGENGFERLMRFAHPMVKLIDFSPGERYLVTYSSHEPSNPRDTHRVVLNIFDVRTGKVMR
DFKGSADDYTTGGNIGVSGVSWPIFRWGGGKDDKYFARLGKNIISVYETNTFSLLDKKSL
KVENVVDFSWSPTDPIISLFVPEMGGGNQPARVSLVQIPGKEELRQKNLFSVSDCKMYWQ
NSGEYLAVQVDRYTKTKKSTYTGFELFRIKERDIPIEVLELENKNDKIIAFAWEPKGHRF
AIIHGDGPRPDVSFYTMRTANNTNRVSKLTTLKAKQANALYWSPAGRFIVLAGLKGFNGQ
LEFYNVDELETMATGEHFMATDIMWDPTGRYLATAVTSVHEMENGFQIWSFNGKHLYKVS
KDHFYQFIWRPRPPSLLSPEKEEEISRNLKKYSKKYEQEDQDAFNQLSEQDRKRRTQLQE
EWDSWVAKWKQMHEEERAFRMELRDGEASDEEEEYEAKEVEVEEVVDVRQEVLAFDLDQE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggcaatctccatggagggcatcgatgcgcgggcgcgggagctcggggtggac
ctctccgctgtcgatctggactccatcaccctcccggccggcgaggacttcggcatcctc
agtgatgatgaggaggtacttcgtagtgaggatcctccagaacttgaaatgggtttatcc
aacattattgtcgtggacaacctgccagttgttcctccagaaaagtttgagaagcttgag
aatgtcatacgcaagatctacagccaaattggtgtgataaaagaaaatggtctatggatg
cctgtaaactcagagacaaagaagacatatggctactgtttcattgagtataatacccct
caggaagctgagctggctagggaaaaaaccaatgggtacaaactcgacaagtctcacatc
ttcgcagttaatttgcttgatgatttcgagaagtacatgaaagttcctgacacatggacc
cccgctgaaattaagccatacactgccggagaaaatcttctgaagtggctaactgatgaa
aaggcccgagaccaatttgtcattcgtgctggcacactaactgaagtttattggaatgat
gcaagaaagctagcacctgagcttgtgtttcaaaagcagtactggacagacagtttcatc
cagtggtcccctctgggaacgtacttggcaacggttcataggcagggatcacaggtgtgg
ggtggtgaaaatggcttcgagcgtttgatgcgttttgctcatcccatggtgaaactgatt
gacttctctcctggcgagagatatttggtcacatacagcagccatgagcccagcaaccct
agagacacacatagggttgtcctgaatatctttgatgtaaggactgggaaggttatgcga
gactttaagggaagcgccgatgattatactactggtgggaatattggggtttctggtgtt
tcatggcctattttcaggtggggtggtggaaaggacgacaaatattttgcaaggcttggg
aagaatataatatctgtctatgaaaccaatacattctcccttcttgataaaaagtctttg
aaggtagaaaatgtagtggacttcagctggtctcccactgatcctatcatctctctgttc
gtgcctgaaatgggtggtggaaatcagcctgcgagggtgagtctagtgcaaatccctggc
aaagaggagctgcgacagaaaaatcttttcagtgtcagtgattgcaaaatgtattggcag
aacagtggagaatatcttgctgttcaagttgatagatacacaaaaacaaaaaagagcacc
tacactgggtttgagctgtttagaattaaggagagggatatcccaattgaggtccttgaa
cttgagaacaagaatgacaagatcattgcatttgcatgggaacctaaaggacatcgcttt
gctatcattcatggtgatggccctaggcctgacgttagcttctacaccatgcgaacagca
aataacactaaccgtgtgtccaagctcacaacactcaaggccaagcaagctaatgctttg
tactggtctcctgctgggcgcttcattgttcttgctggactgaagggtttcaacggacag
ctggaattctacaatgttgatgaactagagacaatggcaacaggagagcattttatggca
acggatattatgtgggatccaactgggagatatctcgcgactgcagttacctcagttcat
gaaatggagaatggctttcaaatatggtcctttaatggcaagcatctttacaaggtgtca
aaggatcatttctatcagttcatatggcgcccgagaccaccctcactgctaagccctgag
aaggaagaagagatctcaaggaacctgaagaagtacagcaaaaagtacgaacaagaggac
caggacgcgttcaaccagttgagcgagcaggaccggaagaggcggacacagcttcaggaa
gaatgggactcatgggttgccaagtggaagcagatgcatgaggaggagcgtgctttcagg
atggagctcagggatggggaagccagtgacgaggaggaagagtacgaggccaaggaagtt
gaggtagaggaagttgttgatgtccgtcaggaagttcttgcattcgacctagatcaggag
tga

DBGET integrated database retrieval system