KEGG   Sorghum bicolor (sorghum): SORBI_01g028700Help
Entry
SORBI_01g028700   CDS       T01086                                 

Gene name
SORBIDRAFT_01g028700, Sb01g028700
Definition
hypothetical protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 557 aa AA seqDB search
MALTLRSSTSFLSPLDPTSKLLHKPADEAPPCCVAMPPAPPSRRPRALRASVAAAAAAAH
SPAAATDRAPAEELLHGGGGAGQQHGLPRGGVPVYVMLPLDTVGPGGQLSRQRAVAASLM
ALRGAGVEGVMVDVWWGVVERDGPGRYDWEAYAELVRMVERAGLRLQAVMSFHQCGGNVG
DTCNIPLPPWVLEEMSSNPDIVYTDRSGRRNPEYISLGCDSLPVLKGRTPIQVYTDYMRS
FRERFRDYLGNVIAEIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEAA
AVAAGHEEWGRGGPHDAGEYKQMPDDTGFFRRDGTWSTEYGHFFLEWYSGMLLEHGDRVL
AAAEAVFGGTGATLSAKVAGIHWHYRTRSHAAELTAGYYNTRDRDGYMPIARMLAKRGAV
LNFTCMEMKDEQQPQHASCSPELLVQQVKAAASKAGVELAGENALERYDEAAFSQVTSTA
RGAGLAAFTYLRMNKTLFDGDNWRQFVSFVRAMADGGARPALPRCDTGHSDLYVGFVDAS
KQRKAPDAESATAAAAV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggctctcacgctgcgttcctcgacgtcgttcctgtcgcccctggaccccacctccaag
ctcctccacaagcccgccgacgaggcgccgccctgctgcgtcgccatgccccctgcgccg
cccagccgcaggccgcgcgcgctcagggcgtccgtggccgcggccgctgccgcggcgcac
tccccggcggcggcgacggaccgcgcgccggcggaggagctgctgcacggcggcggcggc
gcgggccagcagcacgggctgccgcgcggcggggtgccggtgtacgtgatgctgccgctg
gacacggtggggcccggcggccagctgtcgcggcagcgcgccgtggcggccagtctcatg
gcgctgcggggcgccggggtggagggcgtcatggtggacgtgtggtggggcgtcgtggag
cgggacggccctgggcgctacgactgggaggcctacgccgagctcgtgcgcatggtggag
cgcgccggcctccgactccaggccgtcatgtccttccaccagtgcggtggcaacgtcggc
gacacctgcaacatcccgttgccgccatgggtgctggaggagatgagcagcaacccggac
atcgtgtacacggacaggtccggtcgccggaaccctgagtacatctccctcggctgcgac
tcgctgccggtgctcaagggtcggacccccatccaggtctacaccgactacatgcgcagc
ttccgcgagaggttccgtgactacctcggcaatgtcatcgcggagatccaagtgggcatg
ggtccttgtggagagctgaggtatccttcataccctgaggccaacggaacctggcgtttc
ccgggcattggcgagttccaatgctatgacaagtacatgcgggcatcgctggaagccgcg
gcagtggcggccggccacgaggagtgggggaggggtggaccgcacgacgccggcgagtac
aagcagatgcctgacgacacaggcttcttccggcgcgacggtacgtggagcaccgagtac
gggcatttcttcctggagtggtactcgggcatgctcctggagcacggtgaccgcgtcctg
gccgcggccgaggccgtgttcggcggcacgggcgcaacgctctccgccaaggtcgccggc
atccactggcactaccggacccggtcccacgcggcggagctcacggccgggtactacaac
acgcgggaccgcgacgggtacatgccgatcgcgcgcatgctggccaagcgcggcgccgtg
ctcaacttcacgtgcatggagatgaaggacgagcagcagccgcagcacgccagctgctcc
cccgagctgctggtgcagcaggtcaaggccgcggccagcaaagccggggtggagctcgcc
ggcgagaacgcgctggagcggtacgacgaggcggcgttctcgcaggtgacgtcgacggcg
cgcggcgcgggcctggccgcgttcacgtacctgcgcatgaacaagacgctcttcgacggc
gacaactggcggcagttcgtgtccttcgtcagggccatggccgacggcggcgcaaggcca
gcgctgccgcggtgcgacacggggcactcggacctgtacgtcgggttcgtcgacgcctcc
aagcagaggaaggcgcccgacgccgagagcgccaccgccgccgcggcagtgtag

DBGET integrated database retrieval system