KEGG   Sorghum bicolor (sorghum): SORBI_01g028940Help
Entry
SORBI_01g028940   CDS       T01086                                 

Gene name
SORBIDRAFT_01g028940, Sb01g028940
Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SORBI_01g028940 (SORBIDRAFT_01g028940)
  Lipid metabolism
   00062 Fatty acid elongation
    SORBI_01g028940 (SORBIDRAFT_01g028940)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     SORBI_01g028940 (SORBIDRAFT_01g028940)
Lipid biosynthesis proteins [BR:sbi01004]
 Fatty acid synthase
  Component type
   SORBI_01g028940 (SORBIDRAFT_01g028940)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 269 aa AA seqDB search
MGLLVDATSRAGKYGLQEGDATSSAFLNCTPSHQGSVPFLEFVFQVKKMKELSEGYNIVG
LSQGNLIGRAVIEYCDGGPLVKNFISIGGPHAGTASVPLCGSGFVCILIDDLIKSEIYSD
YVQAHLAPSGYLKIPTDMEDYLKGCRFLPKLNNEIPSARNTTYKERFSSLENLVLIMFED
DAVLIPRETAWFGYYPDGAFSPVLPPQETKLYTEDWIGLRTLDEAGRVKFVSVPGGHLRI
SRSDMKKYIVPYLTPEASSKQSVHRMLSL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggttgatgccacttcaagagcaggcaaatacggtttgcaagaaggtgat
gcaacatcttctgcttttctcaattgtacaccgagtcatcaaggttctgtaccatttctg
gaatttgttttccaggtcaagaaaatgaaagagctcagtgaaggttacaatatagttggc
ctgtctcaggggaacttaattggcagggctgtaattgagtactgtgatggtggacctctg
gtcaagaatttcatatcaattgggggtcctcatgctggtacagcttcagtgccactttgt
ggttctgggtttgtctgtattcttattgatgatctgattaaatcagagatatattcagat
tatgtgcaggcacatcttgcccctagtggctacctaaagatacccactgatatggaagat
tatttaaagggttgcagatttcttccaaagcttaacaatgagatcccaagtgcaagaaat
actacctataaagaaagattcagcagcttggaaaacttggtactgatcatgtttgaggat
gatgcagtattaatacctcgggaaacagcatggtttggttattaccctgatggagccttt
agcccagttctgccccctcaagagacgaagctgtatacggaagattggattggcttgagg
accctggacgaggctgggcgcgttaaattcgtgtctgtgcctggaggtcacctgcgtatc
tccagaagcgacatgaagaagtacatcgtgccttacttgacgccggaggcgtcatccaag
cagagcgtacaccggatgctgtcgctttga

DBGET integrated database retrieval system