KEGG   Sorghum bicolor (sorghum): SORBI_01g029600Help
Entry
SORBI_01g029600   CDS       T01086                                 

Gene name
SORBIDRAFT_01g029600, Sb01g029600
Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_01g029600 (SORBIDRAFT_01g029600)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SORBI_01g029600 (SORBIDRAFT_01g029600)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SORBI_01g029600 (SORBIDRAFT_01g029600)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SORBI_01g029600 (SORBIDRAFT_01g029600)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     SORBI_01g029600 (SORBIDRAFT_01g029600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 406 aa AA seqDB search
MPRLAAAAAVSRRAGEALRRGALGRLRLLSSLQPSNAASSDEVLVEGKATARAAVLNRPG
YLNALTTTMGARLNKFYESWEDNPDIGFVMMKGSGRAFCAGGDVVRLRELISEGKLEECK
DFFKTLYMFIYFLGTYLKPHIAILDGVTMGGGGGVSIPGTFRIATDRTVFATPEVHIGFH
PDAAASFYLSHLTGHVGEYVALTGEKLNGTDMIALGLATHYSMSGHLDLIDERLAKLVTD
DPSVIDSSLAQYGDMVYPDKESIVHRLEVIDKCFSHDTVEEIVDALESEAASSNEEWCTL
ALKRLKEASPLALKVSLRSIREGRYQTLDECLVREYRMSMNGISKQFSHEFCEGVRARLV
EKDFTPKWDPPALEYVTNDMVDAYFAPLGDLEPELKLPTESREAFV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcctcgccgccgccgccgccgtatcacgccgcgccggcgaggccctgcgccgc
ggcgcgcttgggagactgcggcttctctcctccctccaaccgtcgaacgccgcctccagc
gacgaggtgctcgtggaaggaaaggctactgcgcgcgccgccgtgctcaaccgccccggc
tacctcaatgccctcaccaccaccatgggagctaggcttaataaattttatgaatcatgg
gaggacaacccagacattggctttgtcatgatgaagggcagcggccgagcattctgtgct
ggtggggatgttgttagattacgtgaacttatcagtgaaggcaagctggaggaatgcaag
gattttttcaagactttgtacatgttcatttattttctgggcacatacttgaaaccacat
attgccattcttgatggtgttactatgggtggtggtggaggtgtttccattcctggaacg
ttccgcattgcaactgatagaacagtctttgcaactccagaagttcatattggattccat
cctgatgctgcagcctcattttatttgtcgcatctaactggtcatgttggggaatatgtg
gccttgactggtgaaaagctcaatggaacagatatgattgctcttggccttgctacacac
tattccatgagtggccatctggatctgatcgatgaacgacttgcaaagttagtaactgat
gatccatcagttattgattcttcccttgcacaatatggagacatggtttatccagacaaa
gaaagcattgttcataggctggaggtgattgataaatgcttcagtcacgacacagttgaa
gagattgttgatgcgttggaaagtgaagcagctagctcaaatgaagaatggtgtaccttg
gcactgaaacgattgaaagaggcctctccgttagctttgaaagtctcactgcgatcgata
cgcgagggtagatatcagacactcgatgagtgccttgtccgtgagtaccgcatgtccatg
aatggaatctcaaagcaattttctcatgaattctgtgagggtgtcagagcacgactagtc
gagaaggacttcactcctaagtgggatcctcctgcccttgaatatgttacaaatgacatg
gttgacgcttacttcgcacctcttggtgatttggagcctgagttgaagctacctacagaa
tcgcgagaggcatttgtatga

DBGET integrated database retrieval system