KEGG   Sorghum bicolor (sorghum): SORBI_01g030680Help
Entry
SORBI_01g030680   CDS       T01086                                 

Gene name
SORBIDRAFT_01g030680, Sb01g030680
Definition
(RefSeq) hypothetical protein
  KO
K20600  
mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
sbi  Sorghum bicolor (sorghum)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 377 aa AA seqDB search
MDSSGGGGGGGGGGAQIKGMATHGGRYVLYNVYGNLFEVSSKYAPPIRPIGRGAYGIVCA
AVNSQTGEEVAIKKVGNAFDNHIDAKRTLREIKLLRHMDHENILALKDVIRPPTRENFND
VYIVTELMDTDLHQIIRSNQPLTDDHCQYFLYQLLRGLKYVHSANILHRDLKPSNLFLNA
NCDLKIADFGLARTTSETDLMTEYVVTRWYRAPELLLNCSQYTAAIDVWSVGCILGEIVT
RQPLFPGRDYIQQLKLITELIGSPDDASLGFLRSDNAKRYMKQLPQFPRQDFRLRFRNMS
PGAVDLLERMLVFDPSRRITVDEALHHPYLASLHDINEEPTCPAPFSFDFEQPSFTEAHI
KELIWRESLAFNPDPPY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggattcctccggcggcggcggcggcggcggcggaggaggagcgcagatcaagggtatg
gcgacgcacgggggccgctacgtgctgtacaacgtgtacgggaacctcttcgaggtctcc
tccaagtacgccccgcccatccgccccatcggccgcggcgcctacggcattgtctgcgcg
gctgtcaactcacagacaggggaggaagttgcgatcaagaaggttggcaatgcgttcgac
aaccacatcgacgccaagcggacgctgagggagatcaagctgctgcgccacatggaccat
gagaacatccttgccttaaaggacgtaatacgccccccaactagagagaactttaatgac
gtgtacattgttactgagttaatggatacagatctccatcagatcatacgctcaaatcag
ccattgactgatgatcactgccagtacttcttgtatcagttgctaagagggctaaaatat
gtgcactcagcaaatatattgcaccgcgatctaaagccgagcaatttgttcctaaatgca
aattgtgacctcaagatcgcagactttgggcttgcaaggaccacctcagagacagatctc
atgacagagtatgtggtcactcgttggtacagggcaccagagctgctgttgaactgttca
cagtacactgctgccattgatgtctggtcagttggatgcatattaggtgaaatcgttact
cgccaacccctgtttcctggacgggattacatccagcagttaaaattgatcaccgagctc
ataggctcaccagatgatgcaagcctgggatttcttcgaagtgataatgcaaaaagatac
atgaaacaactaccacagtttccaaggcaggacttccgcctgcgtttccgtaacatgtct
cctggtgcagtcgatttgttggagagaatgcttgtgtttgatccaagcagacggattaca
gttgatgaggctctgcatcacccatacttggcttcacttcatgacatcaatgaagaacct
acctgccctgcacctttcagctttgattttgagcaaccatcctttacagaagcgcatata
aaagaacttatctggagggaatctttagcatttaacccggatcctccctactaa

DBGET integrated database retrieval system