KEGG   Sorghum bicolor (sorghum): SORBI_01g034390Help
Entry
SORBI_01g034390   CDS       T01086                                 

Gene name
SORBIDRAFT_01g034390, Sb01g034390
Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     SORBI_01g034390 (SORBIDRAFT_01g034390)
Protein kinases [BR:sbi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   SORBI_01g034390 (SORBIDRAFT_01g034390)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 363 aa AA seqDB search
MASEPVARAVAEEVARWGAMRQTGVSLRYMMEFGARPTERTLLLAAQFLHKELPIRIARR
ALDLDSLPFGLSTKPAILKVRDWYVESFRDIRSFPEVRNREDELAFTQMIKMIRVRHTNV
VPAIALGVQQMKKDLGGPKAFPPGIQEIHQFLDRFYMSRIGIRMLIGQHVALHDPDPEPG
VIGLINTKMSPMTVARIASEDARAICMREYGSSPDVDIYGDPGFTFPYVTPHLHLMIFEL
VKNSLRAVQERYMDSDKLAPPVRIIVADGAEDVTIKISDEGGGIPRSGLSRIFTYLYSTA
ENPPDLDGHNEGVTMAGYGYGIPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEE
PLP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggagccggtggcgcgggcggtggcggaggaggtggcgcgctggggcgcgatg
cgccagaccggggtcagcctgcgctacatgatggagttcggggcgcgccccacggagcgg
accctcctcctcgccgcgcagttcctgcacaaggagctccccatccgcatcgcgcggcgg
gcgctcgacctcgactcgctccccttcggcctctccaccaagcccgccatcctcaaggtg
agagattggtatgtggagtcatttcgtgacatccggtccttcccagaggtgaggaaccgg
gaagatgagctcgccttcacccagatgatcaaaatgatcagggtgcggcacaccaatgtg
gtgcccgcaattgcattgggtgtgcagcagatgaagaaggacttgggaggtccaaaggcg
ttcccccctggaatccaggagatccatcagttccttgatcgcttctacatgtcaaggatt
gggatccggatgctgatagggcagcacgtcgctttgcatgaccctgatccagagcctggt
gtgatagggcttataaacacaaaaatgtcacctatgacagtagctcgaattgctagtgaa
gatgcacgtgctatttgcatgcgggagtatggatcatctcctgatgttgacatatatggt
gatccgggttttacatttccatatgttacaccacatctacatctcatgattttcgagttg
gtgaagaactcccttcgcgcggtacaggaacggtatatggattctgataagcttgcacct
ccagttcgaatcatagttgctgatggagcagaggacgtgactattaagattagtgatgaa
ggtggtggtataccaaggagtggcctctcaagaattttcacgtatctctatagtacagca
gaaaaccctcctgatctggatggacataatgaaggagtaactatggctggatatggttat
gggatccctattagtcgtctttatgctcgatatttcggtggggacttgcagatcatctct
atggaaggatatggaactgatgcttacctccacttatcacggctgggagattcagaggaa
cccttgccttaa

DBGET integrated database retrieval system