KEGG   Sorghum bicolor (sorghum): SORBI_01g037900Help
Entry
SORBI_01g037900   CDS       T01086                                 

Gene name
SORBIDRAFT_01g037900, Sb01g037900
Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sbi00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 568 aa AA seqDB search
MKGAVIGASTVLVVAVVATICVVSLRGSGDGDSREEGEMSTSVKSIKSFCQPVDYRETCE
KALRAAAGNATSPTDLAKAIFKVTSDRIEKAVRESAVLNELKNDPRTKGALDNCRELLDY
AIDDLKTTFDRLGGFEMTNFKSAVDDLRTWLSSALTYQETCLDGFENTTTAAAGKMRRAL
NSSQELTENILALVDEFSETLANLGIPSFHRRLLADHAGGVPSWMPDAKRRLRKVSPGDK
GFKPDVTVAKDGSGDFRTINAALAKVPVKSAATYVMYVKAGTYREYVSVPRNVTNLVMVG
DGATKTVITGDKSFMMNITTKDTATMEALGNGFLMRGIGVENTAGAKNHQAVALRVQSDM
SAFYECRFDGYQDTLYTHTSRQYYRECVITGTIDFIFGNAQVVFQNCLIQVRKCMDNQQN
IVTAQGRKERRSAGGTVIHNCTIEPHPEFEKSAGDGKLRTFLGRPWKEHSRTLYIQSEIG
GFIDPKGWLPWLGDFGLSTCYYAEVENRGAGADTSKRVKWRGVKNITYQHALQKYTVESF
IQGQHWLPQLGVPFIPGLLPQNQSGRIH
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgccgtcatcggcgcgtcgaccgtcctggtggtggcggtggtcgccaccatc
tgcgtcgtgtccttgagaggcagcggcgatggcgacagcagggaggagggcgagatgtcg
acgtcggtgaagtccatcaagtccttctgccagcccgtggactacagggagacgtgcgag
aaggcgctcagggcggctgccgggaacgccaccagcccgacggacctggccaaggccatc
ttcaaggtgacgtccgaccggatcgagaaggcggtgcgcgagtccgccgtcctgaacgag
ctcaagaacgacccgcgcaccaagggcgcgctcgacaactgcagggagctgctggactac
gccatcgacgacctcaagacgaccttcgacaggctgggcggcttcgagatgaccaacttc
aagagcgccgtggacgacctccggacgtggctcagctccgcgctcacgtaccaggagacg
tgcctggacgggttcgagaacacgacgacggcggcggcgggcaagatgcgcagggcgctc
aacagctcgcaggagctgacggagaacatcctggcgctcgtggacgagttctccgagacg
ctcgccaacctgggcatcccgagcttccaccgccggctcctggcggaccacgccggcggc
gtgccgtcgtggatgcccgacgccaagcgccggctgcggaaggtctcccccggcgacaag
ggtttcaagccggacgtgacggtggccaaggacggcagcggcgacttcaggaccatcaac
gcggcgctggccaaggtgccggtgaagagcgccgccacgtacgtcatgtacgtgaaggcc
ggcacgtacagggagtacgtgtccgtgccccggaacgtgacgaacctggtgatggtcggc
gacggcgccaccaagacggtgatcacgggcgacaagagcttcatgatgaacatcaccacc
aaggacacggcgacgatggaggcgctcgggaacgggttcctgatgcgcgggatcggcgtg
gagaacacggcgggcgccaagaaccaccaggcggtggcgctgcgggtgcagagcgacatg
tcggcgttctacgagtgccggttcgacgggtaccaggacacgctgtacacgcacacgagc
cggcagtactaccgcgagtgcgtcatcacgggcaccatcgacttcatcttcggcaacgcg
caggtggtgttccagaactgcctcatccaggtgcgcaagtgcatggacaaccagcagaac
atcgtgacggcgcagggccgcaaggagaggaggtcggcgggcggcaccgtcatccacaac
tgcaccatcgagccgcacccggagttcgagaagagcgccggcgacggcaagctcaggacc
ttcctggggcggccgtggaaggagcactcgcgcacgctctacatccagtcggagatcggg
ggcttcatcgaccccaaggggtggctgccgtggctcggcgacttcggcctcagcacctgc
tactacgccgaggtggagaaccgcggggccggcgccgacacgagcaagcgtgtcaagtgg
aggggcgtcaagaacatcacctaccagcacgcgctgcagaagtacaccgtggagagcttc
atccagggccagcactggctcccacagctcggcgtgccattcatcccggggctgctgccg
cagaaccagtctggcaggatacactga

DBGET integrated database retrieval system