KEGG   Sorghum bicolor (sorghum): SORBI_01g038540Help
Entry
SORBI_01g038540   CDS       T01086                                 

Gene name
SORBIDRAFT_01g038540, Sb01g038540
Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SORBI_01g038540 (SORBIDRAFT_01g038540)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    SORBI_01g038540 (SORBIDRAFT_01g038540)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     SORBI_01g038540 (SORBIDRAFT_01g038540)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 589 aa AA seqDB search
MGTYKCCIFFTRRFALADTSTPEDVRALFSRYAGGSPYMLADDLRRYLAAWGGADGEVPE
QIIDRILQDRSRTPRFGRPALTVDDFLHFLFSEDLNPPLRHSKVNQDMNAPLSHYFIYTG
HNSYLTGNQLSSDCSDVPIIKALQIGVRVIELDIWPNSSKDDIDVLHGRTLTAPVSLIKC
LRSIKEYAFVASPYPVIITLEDHLTPDLQAKVAKMVLEVFGDILYYPESKHLQEFPSPEA
LKGRVMLSTKPPKEYLEAKGGTMKEREIEAQFKKGEREEAAWGVEVPDIHEEMQVANRND
DDLLYRERGADGDDEKKTKHVAAEYKHLITIKAGKPKGPLVDALKNDPDKVRRLSLSEQE
LAKVAARHGPNIVSFTHRNMLRIYPKGTRFNSSNYNPFLGWVHGAQMVAFNMQGHGRALW
LMHGFYKANGCCGYVKKPDFLMQTCPDGKVFDPEADLPVKATLKVKVYMGEGWQKDFKQT
HFDTYSPPDFYVKVGIAGVPLDSVMRKTKAVEDSWVPVWEEEFTFPLTVPEIAVLRVEVH
EQDVSEDDFGGQTALPVAELRPGIRAVPLFDHKGLKFRSVKLLMCFEFA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggggacgtacaagtgctgcatcttcttcacgcgcaggttcgcgctcgccgacacctcc
acgccggaggacgtccgcgcgctcttctcccgctacgccggcggctcgccgtacatgctt
gccgacgacctccgccgctacctcgccgcctggggaggtgccgacggcgaggtcccggag
cagatcatcgaccgtatcctgcaggatcgcagccgaaccccgcggttcgggaggccggcg
ctcaccgttgacgacttcttacacttcctcttctccgaggacctcaacccacccctccgc
cactccaaggtcaatcaggacatgaacgcaccgctatcgcactattttatatacactgga
cacaactcgtatctgaccggtaatcaactcagcagtgactgcagtgatgttcccatcatc
aaggcactgcaaataggtgtccgtgtaattgaattggacatatggccaaattcttctaaa
gatgacattgatgttctccatggaaggacactgactgccccagtatcacttatcaaatgc
ttgagatccatcaaagaatatgcttttgttgcatctccctatcctgttattataacacta
gaagaccaccttacacctgatcttcaggcgaaagtagctaagatggtccttgaagtgttt
ggagacatcctgtattaccctgaatcgaaacatcttcaagaatttccttcacctgaagct
ctaaaggggcgtgtcatgctctcaacaaaacccccaaaggagtatctcgaagcaaagggt
ggcaccatgaaggagagagaaattgaggcccagtttaaaaagggtgaaagagaagaagca
gcatggggagtagaagttccagatattcatgaggagatgcaagtcgcgaacaggaatgat
gatgatctattataccgcgaaagaggtgcagatggtgatgatgagaagaaaacgaagcat
gtggcagcagagtataaacaccttatcactatcaaggcaggaaagccaaagggtcctctc
gtggatgccttaaagaacgatccagacaaagttaggcgactcagtttgagtgagcaagaa
cttgcaaaagttgcagcacgtcatggtcccaacattgtgagcttcacgcatagaaatatg
ctgagaatatacccaaagggaacccgcttcaattcatccaactataatccatttcttggc
tgggtgcatggtgctcaaatggtggcattcaatatgcagggacatggaagagcactttgg
ttaatgcatggcttttataaagccaatggctgttgcggttatgtgaagaaaccagatttc
ttgatgcaaacttgtccagatggaaaggtgtttgatccggaggcagatttgccagtgaag
gcaacattgaaggtcaaggtatacatgggggaaggttggcaaaaggacttcaagcagaca
catttcgacacatactcacctccagatttttatgtaaaggttggcatcgccggagttcca
ttagactcggtgatgaggaagacgaaagccgtggaagacagctgggtgccggtgtgggag
gaggagttcaccttcccgctgaccgtaccggagatcgcggtgctccgcgtggaggtgcac
gagcaggacgtgagcgaagacgacttcggcgggcagacggcgctgcctgtggcggagctg
cggccagggatccgcgccgtgccgctgttcgaccacaaggggctcaagttcaggagcgtc
aagctcctcatgtgcttcgagttcgcgtag

DBGET integrated database retrieval system