KEGG   Sorghum bicolor (sorghum): SORBI_01g039260Help
Entry
SORBI_01g039260   CDS       T01086                                 

Gene name
SORBIDRAFT_01g039260, Sb01g039260
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SORBI_01g039260 (SORBIDRAFT_01g039260)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 148 aa AA seqDB search
MAPKAEKKPAEKKPAAEEKAEKAPAGKKPKAEKRLPASKSSGKEGGEKKGKKKAKKSVET
YKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGEAAKLARYNKKPTITSREIQT
SVRLVLPGELAKHAVSEGTKAVTKFTSN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggccgagaagaagccagcggagaagaagccggccgccgaggagaaggcg
gagaaggcgcccgcaggaaagaagcccaaggccgagaagcgcctgcccgcctccaagtcc
tccggtaaggagggcggcgagaagaaggggaagaagaaggccaagaagagcgtggagacc
tacaaaatctacatcttcaaggtgctgaagcaggtgcaccccgacatcggcatctcctcc
aaggccatgtccatcatgaactccttcatcaatgacatcttcgagaagctcgccggcgag
gccgccaagctcgcgcggtacaacaagaagcccaccatcacctcccgcgagatccaaacc
tccgtgcgcctcgtcctccccggagagctcgccaagcacgccgtctccgagggaaccaag
gccgtcaccaagttcaccagcaactga

DBGET integrated database retrieval system