KEGG   Sorghum bicolor (sorghum): SORBI_01g039930Help
Entry
SORBI_01g039930   CDS       T01086                                 

Gene name
SORBIDRAFT_01g039930, Sb01g039930
Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    SORBI_01g039930 (SORBIDRAFT_01g039930)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SORBI_01g039930 (SORBIDRAFT_01g039930)
Protein phosphatases and associated proteins [BR:sbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     SORBI_01g039930 (SORBIDRAFT_01g039930)
Transcription machinery [BR:sbi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     SORBI_01g039930 (SORBIDRAFT_01g039930)
Messenger RNA biogenesis [BR:sbi03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     SORBI_01g039930 (SORBIDRAFT_01g039930)
Spliceosome [BR:sbi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    SORBI_01g039930 (SORBIDRAFT_01g039930)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 322 aa AA seqDB search
MAAAPAAGGQGGVGMDTALVDDIIRRLLEVRTARPGKQVQLSESEIRQLCNVSREIFLSQ
PNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLA
YKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKVFTECFNTLPVAALIDDKI
LCMHGGLSPDLAHLDEIKSLQRPTDVPDQGLLCDLLWSDPGKDVQGWGMNDRGVSYTFGA
DKVSEFLQKHDLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNAGAMMSVDETL
MCSFQILKPAERKNKFMGSNKM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgccagcggcgggagggcagggcggcgtgggcatggacaccgcgctcgtc
gacgacatcatccgccgcctgctcgaggtgcggaccgcgcgccccgggaagcaggtgcag
ctctccgagtcggagatccgccagctctgcaacgtctcccgcgaaatcttcctcagccag
cccaacctcctcgagctcgaggcgcccatcaagatctgcggtgacatccatggtcaatac
agtgatcttctaaggctttttgaatatggaggctttcctcctgaagccaactatctattc
ttaggcgattatgttgatcgaggcaaacaaagtttggagactatatgccttcttcttgct
tacaaaatcaagtaccctgagaacttttttcttctgaggggcaatcatgaatgtgcctcg
ataaacagaatatatggattttatgatgaatgcaagcgtcgatttaatgtgcggctatgg
aaggtcttcacagaatgttttaacactctacctgtggctgctcttatcgatgataaaata
ttatgtatgcacggcggactctcccctgatctagcacacttggatgagataaagagcttg
caacgtccaaccgatgtaccagatcaaggactactgtgtgatttgctttggtcagatcca
ggaaaagatgttcaagggtggggcatgaatgatagaggagtctcatatacctttggcgct
gacaaggtttcagaattcttgcaaaagcatgatcttgatcttatttgtcgtgctcaccag
gttgttgaagatgggtatgaattctttgctgacagacagcttgtcaccatattctcggcc
cccaattattgtggtgaatttgataatgctggtgcaatgatgagtgttgatgaaactttg
atgtgttcgttccaaattctgaagcctgctgagagaaaaaacaaatttatggggtcaaac
aaaatgtga

DBGET integrated database retrieval system