KEGG   Sorghum bicolor (sorghum): SORBI_01g040140Help
Entry
SORBI_01g040140   CDS       T01086                                 

Gene name
SORBIDRAFT_01g040140, Sb01g040140
Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 203 aa AA seqDB search
MEPGAKSEAKQGEARAGSGAGASGSGGGSIKVYHERQRLQFCLLHALNNLMQEKECFTRV
ELDEIAGNLVLNDPNKGQWTPLSFIFKPHHNVITGNYDVNVLITALEARKKKVVWHDRRK
GASSIDLNAEALVGLMINVPVRRFRGLWTGRHWVAIRSIDGVWFNLDSDLSEPKQFKDKE
NVIGFLDSVLSQGGELMVVLQDE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggagccgggagccaaatcggaagcaaagcaaggtgaggcgagagcgggatctggtgcg
ggggcaagcggcagcggcggcggcagcatcaaggtgtatcatgagaggcagaggttgcaa
ttctgtctcctccatgctctcaacaaccttatgcaggaaaaggaatgtttcacccgtgtt
gagttggatgagatcgctgggaatcttgttctcaatgatccaaacaagggccaatggact
cctctatcattcatttttaaacctcaccacaatgttataactgggaactacgatgtaaat
gttctcatcacagcattagaagctagaaagaagaaggtggtttggcatgatcgtcggaaa
ggggcatcatcaattgatctgaatgctgaagcattggtaggcctgatgatcaatgtgcct
gtcaggaggttcagggggctctggactggcaggcattgggtggcaattcgaagcattgat
ggcgtctggtttaatctggacagtgatctttctgaacccaagcagtttaaggacaaagaa
aatgtgattgggttccttgacagtgtgctcagtcaaggtggagaactcatggtcgtgctg
caagacgaataa

DBGET integrated database retrieval system