KEGG   Sorghum bicolor (sorghum): SORBI_01g040140Help
Entry
SORBI_01g040140   CDS       T01086                                 

Gene name
SORBIDRAFT_01g040140, Sb01g040140
Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SORBI_01g040140 (SORBIDRAFT_01g040140)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C86
   SORBI_01g040140 (SORBIDRAFT_01g040140)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 203 aa AA seqDB search
MEPGAKSEAKQGEARAGSGAGASGSGGGSIKVYHERQRLQFCLLHALNNLMQEKECFTRV
ELDEIAGNLVLNDPNKGQWTPLSFIFKPHHNVITGNYDVNVLITALEARKKKVVWHDRRK
GASSIDLNAEALVGLMINVPVRRFRGLWTGRHWVAIRSIDGVWFNLDSDLSEPKQFKDKE
NVIGFLDSVLSQGGELMVVLQDE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggagccgggagccaaatcggaagcaaagcaaggtgaggcgagagcgggatctggtgcg
ggggcaagcggcagcggcggcggcagcatcaaggtgtatcatgagaggcagaggttgcaa
ttctgtctcctccatgctctcaacaaccttatgcaggaaaaggaatgtttcacccgtgtt
gagttggatgagatcgctgggaatcttgttctcaatgatccaaacaagggccaatggact
cctctatcattcatttttaaacctcaccacaatgttataactgggaactacgatgtaaat
gttctcatcacagcattagaagctagaaagaagaaggtggtttggcatgatcgtcggaaa
ggggcatcatcaattgatctgaatgctgaagcattggtaggcctgatgatcaatgtgcct
gtcaggaggttcagggggctctggactggcaggcattgggtggcaattcgaagcattgat
ggcgtctggtttaatctggacagtgatctttctgaacccaagcagtttaaggacaaagaa
aatgtgattgggttccttgacagtgtgctcagtcaaggtggagaactcatggtcgtgctg
caagacgaataa

DBGET integrated database retrieval system