KEGG   Sorghum bicolor (sorghum): SORBI_01g040320Help
Entry
SORBI_01g040320   CDS       T01086                                 

Gene name
SORBIDRAFT_01g040320, Sb01g040320
Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SORBI_01g040320 (SORBIDRAFT_01g040320)
Translation factors [BR:sbi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SORBI_01g040320 (SORBIDRAFT_01g040320)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 229 aa AA seqDB search
MEAAVEKKEAEQEEQQLPHARKDDAPAAAEEDEADAEETERRNRDLKAGLHPLRRKLVLW
YTRRTPGARSQAYEDNIKKIIDFSTVESFWVCYCHLARPSSLPSPTDLHLFKDGIRPLWE
DPANQNGGKWIIRFKKAVSGRFWEDLVLVLVGDQLEYSDDVCGVVLSVRFNEDILSVWNR
NASDHQAVMALRDSIKRHLKLPHSYLMEYKPHDASRRDNSSYRNTWLRG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggtggagaagaaggaggccgagcaggaggagcagcagctaccgcacgcg
cggaaggatgacgcgcccgccgccgccgaggaagacgaagcggatgcggaggagaccgag
cgccgcaaccgcgacctcaaggctggcctccacccccttaggcgcaaactcgtgctctgg
tacacccgccggacgcctggagcgaggtcgcaggcgtacgaggacaacatcaagaagatc
atcgatttcagcacagtcgaatcgttctgggtttgctactgccaccttgcgcgcccttct
tcactgccgagccccactgaccttcatctctttaaggacggcatccgtcccctctgggag
gatcctgcaaatcagaatggtggcaagtggataattagattcaaaaaggcagtttcaggt
cgtttctgggaggatttggtgctggtgctagtaggcgaccaacttgaatatagtgatgat
gtttgtggtgttgtgcttagtgtccgtttcaatgaagacattctgagcgtctggaatcgg
aacgcatcagaccatcaggctgtgatggcattgagggattctatcaagaggcacctcaag
ctgccacacagctatctgatggagtacaaaccacatgatgcttcgcggcgtgacaactcg
tcctacaggaacacatggctgagaggataa

DBGET integrated database retrieval system