KEGG   Sorghum bicolor (sorghum): SORBI_01g044530Help
Entry
SORBI_01g044530   CDS       T01086                                 

Gene name
SORBIDRAFT_01g044530, Sb01g044530
Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SORBI_01g044530 (SORBIDRAFT_01g044530)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SORBI_01g044530 (SORBIDRAFT_01g044530)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 366 aa AA seqDB search
MGAAGSRLEKALGEQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFRDQLLEYYANNKN
TGDVEENMLTCLADLFSQISNQKKKTGVIAPKRFIQRLKKQNEIFRSYMHQDAHEFLNFL
LNELVDILEKEHNAAREPLQNLPFQKNSNGTIDGQPNGSHKELAATWVHKCFQGILTNET
RCLRCETVTDRDETFFDLSLDIEQNSSLTSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK
RMKIKKPPNILVIHLKRFKYIEQLQRYKKLSYRVVFPLELKLLNTVDNSDLEYSLFAVVV
HVGSGPNHGHYISLVKSHNHWLFFDDENVEMTDESMVQAFFGSPQEFSGNTDNGYILFYE
SLAERS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcgggctccaggctggagaaggcgctgggcgagcagttccccgagggcgag
cgctacttcggcctcgagaacttcggcaacacctgctactgcaacagcgtgctgcaggca
ctttatttttgtgttcctttccgtgatcaattgctggagtactatgcaaacaacaaaaac
accggagatgttgaagagaacatgctaacctgcctggctgatctgttctctcagatcagt
aatcagaagaagaaaacaggggttattgctcctaagcgttttatacaacgattgaagaaa
caaaatgagattttccgcagctatatgcatcaggatgctcacgagtttctgaattttttg
ctgaatgagctagttgacattctagagaaggaacataatgctgcaagagaacctcttcaa
aatctcccattccaaaagaattcaaatggcactattgatggccaacccaatggtagtcac
aaagaattagctgccacatgggttcataaatgcttccagggaatattgactaatgaaaca
aggtgtctgagatgtgaaactgtgactgatagagatgaaacattttttgacctgagcctg
gacattgaacagaatagttcactcaccagctgtcttaagaacttcagctcaacagagact
ttgaatgctgaggacaagttcttctgtgacaaatgctgcagtttacaggaagcacaaaaa
aggatgaagataaaaaaaccaccaaacatcctagtaattcatctcaaacggttcaagtat
attgagcagcttcagcgctacaaaaaactatcataccgagtggttttcccactggagctt
aaacttcttaacacagttgataattcggacttggaatactcccttttcgctgtggtagtt
catgttggaagtgggccaaatcatggccactatatcagtttggttaagagccacaatcat
tggttattctttgatgacgagaacgttgagatgactgatgagtccatggtacaggcattc
tttggctcaccgcaagagttcagtggtaacactgataatggctacatactcttctacgaa
agccttgctgaaagaagttga

DBGET integrated database retrieval system