KEGG   Sorghum bicolor (sorghum): SORBI_01g044830Help
Entry
SORBI_01g044830   CDS       T01086                                 

Gene name
SORBIDRAFT_01g044830, Sb01g044830
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 296 aa AA seqDB search
MAFSSSLAPFFAPSGTFGARPEKRLRADAPGRFVASSSPPPDVVVTREQGKNARLIAALE
KHNIHSLELPLIKHVEGPDTERLSDVLRNDKFDWITITSPEAAAVFLQGWKAAGSPKVRI
AVVGAGTARVFHEVSESDDQSFEVAFSPSKALGKVLASELPRSNENSCKVLYPASAKAGH
EIQDGLSERGFDVTRLNTYTTVPVEDVEPLTLNLAISAPVVAVASPSALRAWLNLISKVD
SWNNSIACIGETTASAAKKLGLKSIYYPTTPGLEGWVDSILEALRVHRTSKEAPKC
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggccttctcttcgtcactggcgcccttcttcgcaccttctggaaccttcggagcccgt
cccgaaaagaggctccgggccgatgcacccgggaggttcgtagcgtcctcctcgccccct
cccgacgtcgtggtgacgcgggagcagggaaagaacgccaggctcatcgccgcgctggaa
aagcataatatacactctctggaacttcctcttattaagcatgttgaaggccctgataca
gagaggctttcagatgtcttgcgtaatgacaagttcgactggattactataacctctcct
gaggcagctgcagtgttccttcagggatggaaagctgctggaagtcctaaggtgcgaata
gctgttgttggagcaggaactgcaagggtttttcatgaagtatcagaatctgatgatcaa
tcttttgaggttgcattttcaccttccaaagctttaggtaaagtcttggcttcagagctt
ccaaggagcaatgagaattcatgtaaagtattgtatcctgcatctgcaaaggctggccat
gaaattcaggatgggctatcagaacgaggatttgacgtgacacgactgaatacatataca
actgttcctgtagaagatgtggaaccactaacattaaatcttgctatatcagctccagtt
gttgcggtagcttctccttctgcactgagggcatggttaaatcttatttcaaaagttgat
agctggaacaactccatcgcttgcatcggtgagaccactgcatcagcagccaagaaattg
ggcctgaagagcatatattacccaacaacccctggacttgaggggtgggttgacagcatt
cttgaggcgctcagagtccacaggacatcaaaagaggccccaaaatgttga

DBGET integrated database retrieval system