KEGG   Sorghum bicolor (sorghum): SORBI_01g046360Help
Entry
SORBI_01g046360   CDS       T01086                                 

Gene name
SORBIDRAFT_01g046360, Sb01g046360
Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SORBI_01g046360 (SORBIDRAFT_01g046360)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     SORBI_01g046360 (SORBIDRAFT_01g046360)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     SORBI_01g046360 (SORBIDRAFT_01g046360)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 181 aa AA seqDB search
MDDSEEDQRLPHHREPKEFIPLDKLSELGILSWRLNADDWENDEKLKKIREARGYSYMDI
CDVCPEKLPNYEAKIKNFFEEHLRTDEEIRYCLEGSGYFDVRDENDQWIRVAVKKGGMIV
LPAGMYHRFTLDTDNYIKAMRLFVGEPVWTPYNRPHDHLPARKEYVEKIINRGGNQAVEA
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggatgacagtgaagaggaccagaggcttcctcatcatcgcgagcccaaagaattcatt
cctctcgacaaactttcagagctaggaatattaagctggcgcctaaatgctgatgattgg
gagaatgatgagaagctcaagaaaattcgtgaagccaggggttactcttacatggacatt
tgtgatgtgtgcccagagaagttgccaaattacgaggctaagataaagaatttctttgaa
gaacacttgcgtactgatgaagagatacgatattgtcttgagggtagtggctactttgat
gtgagggacgaaaatgatcagtggatccgtgtagcagtgaagaaagggggcatgattgtt
ttgcctgcaggaatgtatcaccgctttacattggataccgacaactacatcaaggcaatg
cggctctttgtgggcgagcctgtgtggacgccatacaatcgtccccatgaccatctcccg
gctaggaaggagtatgttgagaaaatcatcaacagaggtggaaaccaagccgtcgaagct
cgttga

DBGET integrated database retrieval system