KEGG   Sorghum bicolor (sorghum): SORBI_01g050600Help
Entry
SORBI_01g050600   CDS       T01086                                 

Gene name
SORBIDRAFT_01g050600, Sb01g050600
Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sbi01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:sbi00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 332 aa AA seqDB search
MRRTAAAALVFIPLLAAAVQTSSLPFIVLHGIGDQCANHGVAKFTKLLAGWSGSDGHCLE
IGRGTWDSWVMPLQQQADIICNKVKEMKQLRDGYNIVGLSQGNLIGRAVVEYCDDGPPVK
NFISLGGPHAGTASVPLCGSGILCILVDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYL
KSCRFLPKLNNEIPEKRNATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDP
VLPPQKTKLYEEDWIGLKTLDKAGRVKFVSVAGGHLGISKSDMKKYIVPYLTSKASVKTL
LRWSLSDLLGGTWHAALGLMEGDGAVLDSPSS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcggagaacagccgccgctgccctcgttttcattcccctcctcgctgcggcggtgcag
acctcctccctgcccttcatcgtcctgcacgggattggggaccagtgcgccaaccatggc
gtcgccaagttcactaaacttctcgccggttggtccggctccgacggtcactgcctagag
atcggcagaggaacatgggactcttgggtcatgcctcttcaacaacaggctgatatcatc
tgcaacaaggtcaaggaaatgaaacaactgagagacggctacaacatagttggtctgtct
cagggaaacttgattggtcgagcagtagttgagtattgtgatgatggaccgccggtcaag
aacttcatctctcttggaggtcctcatgctggtaccgcttctgtgccgctttgtggttct
ggtattttgtgcattcttgttgacgctctgatcaaattggagatctactcagactatgtg
caggaacatcttgcacctagtggctacctcaaaatcccaactgatatggcagattatctg
aagagttgcaggtttcttccaaaacttaacaatgagattccagaaaaaagaaatgccacc
tacaaggaaaggtttagcagcttagagaatttggttctgatcatgtttcaggatgatgca
gtcctgatacctcgagaaacagcatggttcggttactaccctgatggagcctttgatcct
gttctaccacctcagaagacgaagctgtatgaggaagactggatcggtttgaagacactg
gataaagcagggcgggtgaagtttgtgtctgtggcgggaggtcacctcggcatctccaaa
agtgacatgaagaagtacattgtgccttacctgacaagcaaagcatcggtgaagaccctc
ctccggtggagcctttctgatttgctaggtggcacttggcacgctgcgctggggctgatg
gagggtgatggtgctgtgcttgattcgccatcgtcgtga

DBGET integrated database retrieval system