KEGG   Sorghum bicolor (sorghum): SORBI_02g003380Help
Entry
SORBI_02g003380   CDS       T01086                                 

Gene name
SORBIDRAFT_02g003380, Sb02g003380
Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 867 aa AA seqDB search
MATAATASHPASASTSGRDALAASSSSHAAVCLVPFRWWARVREEEAAGGVQYAATAAAS
PSYYGLRLLHSFLHPDLVLRLERGDFRAGDGGGGGRSYALVPADELSRALARQNSGLGLQ
NKHSFAGDSAGAYPLVLRISVRETSILTLKISKKDNPVENYKRANKIFNVDSQPVHVWDF
SGQTNLILMNEWNRLHDCCHADQENLLEVQVYAMSDSLTSKIGGDMNSDLSYRSFGRAGS
MGLIGLENLGNTCFMNSSIQCLAHTPKLVDYFLGDYANNINRTNPLGLNGELALAFGELL
RSLWTDRKPIPPHHFKEKIACFAPQFSGFNQHDSQELLAFLLDGLHEDLNQVKCKPYEEA
KDASGRPDEEVADEYWSNHLARNDSVIVDTCHGQYKSTLTCPTCSKTSVTFDPFMYLSLP
VPSTAKRVMTVTVFSTDGSREPCSYDVSVPKFGTLSDLVQALSIACLLGDDEILLVTEVY
NNCIIRYLEEPSDSVSLLRDGDKLAAYRLPKRHEKSPFVVFTHQYFDEHSSDDNLTRQMR
EFEAPLLAALPETINGLSLQDIYLKLLSPFRLSNRAGSLNVCMESNSDSIDLTDATSSDS
GSNSFQNSQSEDGPESSHCSASECEIMKRPDDLCDGGSDSNKEAQMEEFEFYLKNERGDG
QLQKIEINELDLLETAPSRLHVNVHWLRNASKKYATSMLSNLPEIHKLELIPKGTEDSVA
LHGCLEAFLKEEPLGPEDMWYCPCCKKHQQAMKKLDLWRLPEVLVIHLKRFSYTQFTRNK
LETFVDFPTTDLDLSSYIADKSKQPSSHYRLYAISNHYGNMGGGHYTASIYHEEGKGWYK
FDDDYVTPMSEDSIKTSAAYVLFYRRE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgccaccgcctcccacccggcctccgcctccacctccggccgcgacgcc
ctcgccgcatcatcctcctcccacgccgccgtctgcctcgtcccgttcaggtggtgggcg
cgggtgcgggaggaggaggcggcgggcggggtgcagtacgcggctaccgccgccgcgtcc
ccgtcctactacggcctcaggctgctccacagcttcctgcacccggatctcgtcctgcgc
ctcgagcgcggggacttccgcgccggtgacggaggcggaggcggccgcagctacgcgctc
gtcccggccgacgagctctccagggcgcttgctaggcaaaactctggtttgggtttacaa
aataagcattcgtttgctggagatagtgctggtgcttatcctttagtgcttaggatctct
gtccgagaaacaagtatattgacactgaagatcagcaaaaaggacaatccagttgagaac
tacaaacgggctaacaagatttttaatgttgattctcaaccagttcatgtttgggatttt
tcagggcagacaaacctaatattaatgaatgaatggaatagactacatgactgctgccat
gcagatcaagagaatcttctggaagtgcaagtctatgcaatgtctgactccttaacatcc
aaaattggtggtgatatgaattctgatttgtcctacagaagctttggaagagctggttct
atggggttaataggattggagaatcttggaaatacttgctttatgaacagttcaattcaa
tgtttggctcacacaccaaagcttgttgattacttccttggtgattatgccaataatata
aaccggactaatccattgggactgaatggtgaacttgctttggcgtttggagaactgttg
aggagcttatggactgacagaaaacccattccacctcatcatttcaaggaaaaaattgcg
tgttttgctcctcagttcagtggctttaatcagcatgattcacaggagcttcttgctttt
ttattggatggtcttcatgaagatcttaaccaggttaaatgtaaaccgtatgaagaagca
aaagatgcaagtggccgtcctgacgaagaagtagcagatgagtattggagcaaccatcta
gctcgaaatgattctgttatagttgatacatgccatggacaatataaatctacattaact
tgtcctacttgcagtaaaacatctgtcacatttgacccatttatgtacttatctttgcct
gtaccttccacggcaaagagggtaatgaccgtaacagttttcagcactgatggtagcaga
gagccatgctcatatgatgtcagtgtgccaaaatttgggactctgagtgatcttgttcag
gctttaagcattgcttgcttacttggagatgatgagatcctgctggttacggaggtctac
aataactgcatcattcgatacttggaggagccttcagattcagtttcattgctgagggat
ggagataaactggcagcataccgtctacccaaaagacatgagaaatccccctttgtggtt
tttacacatcaatattttgatgagcattctagtgatgataatttaactcgacaaatgagg
gagtttgaggccccacttttggcagcacttccagagacaattaatggattatcccttcag
gatatctacctaaagttgttgagtccatttcgactttccaacagggctggttcacttaat
gtttgtatggagtctaatagtgactccatcgatctgacggatgcaacgtcttctgattca
ggcagtaatagttttcagaacagccaatcggaagacggccctgaaagcagccactgtagt
gctagtgaatgtgaaataatgaaaagacctgatgatttatgtgatgggggttctgattct
aacaaggaggcacagatggaggagtttgaattttatttaaaaaatgaaaggggtgatggc
cagcttcagaagatagaaatcaatgagctcgatttacttgagacagcaccaagccggttg
catgtgaatgtccactggctacgaaacgcttcaaaaaaatatgctacctcaatgctgagc
aatctacctgagattcacaagcttgagcttatcccgaaaggaactgaagattctgttgca
ctacatggttgtctggaagcctttctaaaagaggaaccattgggaccagaggacatgtgg
tattgcccctgctgcaagaagcatcaacaagcaatgaagaaacttgatctctggaggctg
cccgaagttctggtgatccacctcaaaaggttctcctacactcagttcacaagaaacaag
ctggagacattcgttgacttccccaccaccgatttggatctgtcatcctacatcgctgac
aagagcaagcagccaagcagccattatcgcctgtatgctattagcaaccactacggaaac
atgggagggggccattataccgccagcatctatcacgaggaagggaaggggtggtataag
ttcgatgatgactacgtgactcctatgagcgaagacagtataaagacctcggctgcttac
gtgctgttctacagacgagagtga

DBGET integrated database retrieval system