KEGG   Sorghum bicolor (sorghum): SORBI_02g004580Help
Entry
SORBI_02g004580   CDS       T01086                                 

Gene name
SORBIDRAFT_02g004580, Sb02g004580
Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SORBI_02g004580 (SORBIDRAFT_02g004580)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SORBI_02g004580 (SORBIDRAFT_02g004580)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SORBI_02g004580 (SORBIDRAFT_02g004580)
Enzymes [BR:sbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SORBI_02g004580 (SORBIDRAFT_02g004580)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 320 aa AA seqDB search
MAFALKAAATGSASFSAAGPRRGAASATGRVSFRGAAPAVAVRAAAAAAAAVAEDKRSIS
GTFAELREQGKTAFVPFITAGDPDLSTTAKALKILDACGSDVIELGVPYSDPLADGPVIQ
ASATRALAKGTTFEDVISMVKGVIPELSCPVALFTYYNPILKRGIPKFMSIVKEAGVHGL
VVPDVPLEETDVLRSEAAKNNLELVLLTTPTTPNERMEKIAQASEGFIYLVSTVGVTGTR
ANVSGKVQSLLQDIKKVTEKPVAVGFGVSTPEHVQQIAGWGADGVIVGSAMVRLLGEAAS
PEEGLKKLEELAKNLKAALP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgcgctcaaggccgccgccacggggtcggcgtcgttctccgccgcggggccg
aggcggggcgccgcctccgccacggggagggtctcgttccggggcgccgcgcccgcggtc
gccgtcagggccgcggcggctgccgccgccgctgttgcggaggacaagcgcagcatctcc
ggcaccttcgccgagctcagggagcaggggaagactgccttcgtccccttcatcactgct
ggtgaccctgacttgtccaccacagcaaaagcactcaagatccttgatgcgtgtggttcg
gatgtcattgaattgggtgtgccttactctgatccattggctgacggccctgttattcag
gcctctgcgacacgcgcgctagcaaagggcaccacatttgaggatgtcatctccatggta
aagggggtcatacctgagctgtcctgccctgtagcacttttcacatattacaacccgatt
ctgaagcgtggcatcccgaagttcatgagtattgttaaagaagctggtgtacatggtctt
gtggtaccagatgttcctttggaggagacagatgttctaaggagtgaggctgccaaaaac
aacctagagctggtgctactgacaacaccgactacaccaaatgaaagaatggagaaaatt
gcacaggcttcagaaggatttatttatcttgtaagcactgttggagttactggtacacgt
gcgaacgtgagtggcaaggtgcaatctcttcttcaggatatcaagaaggtgacagaaaaa
cctgtggcggttggctttggtgtgtcgactccagagcatgtccagcagattgcaggatgg
ggcgcagatggtgtgatcgttggtagcgcaatggtgaggctattgggggaagctgcttct
ccagaagaaggattgaagaagctagaagagttagccaagaacctgaaggctgcattgcca
tga

DBGET integrated database retrieval system