KEGG   Sorghum bicolor (sorghum): SORBI_02g006620Help
Entry
SORBI_02g006620   CDS       T01086                                 

Gene name
SORBIDRAFT_02g006620, Sb02g006620
Definition
hypothetical protein
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SORBI_02g006620 (SORBIDRAFT_02g006620)
Enzymes [BR:sbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SORBI_02g006620 (SORBIDRAFT_02g006620)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 830 aa AA seqDB search
MAQQMASVPLNDAAVVDAKPLRTLTPMFPAPLGLHTFTHQNSPSVVCVTPFGPYAGGTEL
GKPAVPPMFAAPTPAAEAEPSQRQLDTANMNGAAHANGTAVNSLVTPLQTPPSAATQESG
KRKRGRPKRVLDTTVASVPSAPLATTIPPVPSLPVVTPVPSAPQEGNTIVSLTPSSDAPQ
ESGKRKRGRPKRVQDVPVMAPPTSQGDSTPVIQTLPGPSVHEFGTRKRGRPKRLQDSSDI
ATPIDSKDLPISSPQPLSAAAPAESGKRKRGRPKRVLDGSATPSSHSGFSIDGDAVDTMK
RGRPRKIDTNLLQLPSLSSDDPRQTADNVLMMFDALRRRLMQMDDVKQVAKQQPNLKAGS
IMINAELRVNKNKRIGEVPGVEVGDMFYFRIEMCLVGLNSQSMAGIDYMSAKFGNEEDPV
AISVVSAGVYDNTEDDPDILVYTGQGMSGKDDQKLERGNLALERSLHRGNPIRVIRSVKD
MTCPTGKIYIYDGLYKIKEAWVEKGKSGFNVFKHKLLREPGQPDGIAVWKKTEKWRENPS
SRDHVILLDISYGVESNPVCLVNEVDDEQGPSHFTYTTKLTYGNSLNSMRKMQGCKCISV
CLPGDNSCSCTHRNAGDLPYSASGILVSRMPVLYECGDSCTCSYNCRNRVVQKGTQIRFE
VFKTGERGWGLRSWDPIRAGTFICEYAGEIIDRNSVTGEDDYIFETSPSEQNLRWNYAPE
LLGEPSLSDSNETPKRLPIVISAKRTGNIARFINHSCSPNVFWQPVLYDHGDEGYPHIAF
FAIKHIPPMTELTYDYGQNHHPNIQMGTHSSFGKSKSCLCWSPKCRGSFG
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaaatggcttcagttcctttgaatgatgcagcagttgttgatgccaagccc
ttgcgtacattgactcccatgttccccgcaccattagggcttcacacattcactcatcaa
aactcaccttcagttgtttgtgtgaccccatttggaccatatgctggaggcactgaattg
gggaagcctgctgttccaccaatgtttgcagcgcccacacctgctgcagaagcagaaccc
agccagagacaactggatacagctaatatgaatggagctgctcatgctaatggtactgca
gtcaacagtttggtcacacctttgcaaactcctccgtcagctgccacacaggaatctggt
aagaggaagaggggcaggccaaagcgtgtgcttgatactactgttgcttcagttccttca
gctcctctggctactactattcctccagttccttcccttcctgtggttactccagttcct
tcagctcctcaggaaggtaacactattgtttccctgacgccttcttcagacgccccacaa
gaatctggcaagaggaagaggggacgacccaaacgtgtacaagatgttcctgtaatggct
cctccaacctcccaaggagatagcacgcctgttattcagacacttccagggcccagtgtt
catgaatttggtacgaggaaaaggggacgacccaaacgtttgcaggatagttcagatatt
gccactccaattgactcaaaagatttacctatatcctctccccagccactttctgctgca
gcacctgctgaaagtggtaagaggaagaggggccgtccaaagcgcgtgcttgatggatca
gcgactccatcaagtcattcaggtttttcaatagacggtgatgctgttgacacaatgaaa
cgtggacgacctaggaaaattgacaccaatctgttacagcttccatctttatcttcagat
gatcctaggcaaactgcagataatgtactcatgatgtttgacgccctgcgacgcagactt
atgcagatggatgatgtgaaacaagttgcaaagcagcagcctaacttgaaggctgggagc
atcatgatcaatgctgaacttcgtgtcaataagaacaagaggataggagaggttccaggt
gttgaggttggtgatatgttctacttcagaattgagatgtgcttagtggggctgaatagt
cagagcatggcagggatagattacatgtctgccaagtttggtaatgaggaggaccctgta
gctattagtgttgtatcagctggtgtatatgataacactgaagatgatccagatatttta
gtttacactggacagggcatgtctggtaaggatgaccaaaaacttgagaggggtaatctt
gcactggagaggagtttgcatagaggtaatccaatcagagtcattcgtagcgtaaaagat
atgacgtgtccaactggcaagatttacatatatgatggcctttacaagatcaaagaagcc
tgggtagagaaagggaaatctggtttcaatgtgtttaaacacaagttgcttagggaacct
ggccaacctgatggcattgcagtatggaagaagactgaaaaatggagggaaaatccatca
tctagagaccatgttatattgcttgacatatcatatggtgtggaaagtaaccctgtctgc
cttgtaaatgaggttgatgatgagcagggccctagccacttcacctatacaactaaattg
acatatgggaattctctgaactcgatgagaaagatgcaaggttgcaaatgcattagtgtg
tgcctacctggtgataacagctgctcttgtacgcatcgaaatgctggtgaccttccttac
agtgcttcaggcatacttgttagccgcatgcctgttttatatgagtgtggtgattcctgc
acatgttcatacaattgccggaaccgagttgtacagaaaggtacacagatccgttttgaa
gtttttaagacaggagaacgtggttggggcctccgtagttgggatccaattcgagcaggc
acatttatctgtgaatatgcaggtgaaatcattgacagaaatagcgtgactggtgaagat
gactacatatttgagacttctccttcagagcagaatttaagatggaactatgcaccagaa
ttgctgggtgaacctagtctttctgactcaaatgagacacctaagcgactgcctatagtc
atcagtgcaaaacgaaccggcaacatagctcgctttataaaccacagttgctcacctaat
gtgttttggcaaccagttttgtatgatcatggtgatgagggatatccacatattgcattc
tttgcaattaagcatattcctccaatgacagagcttacctatgattatggtcagaaccat
catcctaatattcaaatgggaacacattctagttttgggaagtctaaaagttgcttatgt
tggtcccccaagtgtagaggttcctttggctaa

DBGET integrated database retrieval system