KEGG   Sorghum bicolor (sorghum): SORBI_02g012500Help
Entry
SORBI_02g012500   CDS       T01086                                 

Gene name
SORBIDRAFT_02g012500, Sb02g012500
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SORBI_02g012500 (SORBIDRAFT_02g012500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 299 aa AA seqDB search
MAPKRRGNKVVGSVVKTKVVQETVEVIVADDDDTAEAEQQMVPEALAVAPSAVDVSGSTV
VHVVEVTTPDGGDNATGSNVKQPAVAKRGRGRREEEKEKQPAPPEDSVLVPQSQETQDPN
EEEEDQEDASKKKKQKQKQRQQDEDDEAQPETPRVASERKKATPKKAKAKAQPQQQAGGG
GDAGKKRPKARRRLGQASAGGDAGMGGVGGYKRYVWRVLKQVHPDLGVSGHAMQVLDMMM
ADMFERLADEAARLSKATGRMTLTSREVQSAVRLVLPGDLGKHAIAEGTKAISKYMSYA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagcggcgcggaaacaaggtggtgggctccgtggtgaagaccaaagtggtg
caggagaccgtggaggtcattgtcgccgacgacgatgatacggcggaggcggagcagcag
atggtcccggaggcccttgccgtggcgccttccgccgtggacgtctccggctccacggtg
gtgcacgtcgtcgaggtcactaccccggacggcggcgacaatgccaccggctccaatgtg
aagcagcccgccgtcgccaagagaggccgtggcaggcgcgaggaggagaaggagaagcag
ccggctccgccggaggattctgtactcgtgccgcagagccaggagacgcaggaccccaac
gaggaggaggaggatcaggaggacgccagcaagaagaagaagcagaagcagaagcagcgc
cagcaagacgaggacgacgaggcgcagccggagactccgcgggtggcgtcggagaggaag
aaagcaacaccaaagaaggcgaaggcgaaggcgcagccgcagcagcaggcgggtggcggt
ggcgacgccggcaagaagcggccgaaggcgcggcgccggctggggcaggccagcgccgga
ggcgacgccggcatgggcggcgtcggagggtacaagcggtacgtctggcgcgtgctgaag
caggtgcacccggacctcggggtgtcggggcacgccatgcaggtgctggacatgatgatg
gccgacatgttcgagcgcctggcggacgaggcggcgcgcctgtccaaggccacggggagg
atgacgctcacctcccgcgaggtgcagagcgccgtcaggcttgtgctccccggggacctg
ggcaagcacgccatcgctgagggcaccaaagccatctccaagtacatgtcctacgcctag

DBGET integrated database retrieval system