KEGG   Sorghum bicolor (sorghum): SORBI_02g012600Help
Entry
SORBI_02g012600   CDS       T01086                                 

Gene name
SORBIDRAFT_02g012600, Sb02g012600
Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SORBI_02g012600 (SORBIDRAFT_02g012600)
   03420 Nucleotide excision repair
    SORBI_02g012600 (SORBIDRAFT_02g012600)
   03430 Mismatch repair
    SORBI_02g012600 (SORBIDRAFT_02g012600)
   03440 Homologous recombination
    SORBI_02g012600 (SORBIDRAFT_02g012600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 194 aa AA seqDB search
MAEGSGVSLTRQGQAASVSRENGEAAKKARRRRGGQVAPTVVRLVGRMLNKVQHVKDVQF
TLHDGAGKIDVNRWENESSDAKEIADVNFTSDGDYVIVNGGLKGFQGKRHIVAYSVRRVT
DFNEIPHHFLHCIQVHLDHTRPKAQINASTATLGHTNQVRPFNNQAATFSASGNAAGNSI
SDLVMSVFNDPEAM
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggtagcggcgtgagcctgacgaggcaggggcaggccgccagtgtcagcagg
gagaatggggaggcagccaagaaggcgaggaggaggcgtggtggtcaggtggcgccgacg
gtcgttaggcttgttggacgcatgttgaataaggttcagcacgtcaaagatgttcaattc
actcttcatgatggtgccggcaagatagatgtgaatcgttgggaaaatgagtcttccgac
gctaaggaaatcgctgatgtcaattttacaagtgacggggactatgttatagtcaatggc
ggtttgaaaggttttcaaggaaagcgccatatagttgcctactctgtgcggcgtgtgaca
gacttcaatgaaataccccatcactttctgcactgcattcaggtgcatctggatcacacc
aggccaaaggcccaaataaatgccagtacggcaacccttggtcatactaaccaagttcgg
ccctttaataatcaggctgcaacgttttctgcatcaggaaatgctgctggaaacagcata
tctgacttggtcatgagtgtttttaatgatccagaagccatgtaa

DBGET integrated database retrieval system