KEGG   Sorghum bicolor (sorghum): SORBI_02g020430Help
Entry
SORBI_02g020430   CDS       T01086                                 

Gene name
SORBIDRAFT_02g020430, Sb02g020430
Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbi01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sbi00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 403 aa AA seqDB search
MESSIAAAATSVVVRTSVPAVVFMPSLSSSSSSFLSRPALRTGRRRAFRCSSSSSSVVAK
QDSAISSAAALYCRLDDKLFMSPEVFQWESGKSLNAIASAQGIQIRRRCRARYPSEGTGA
ERAVPRNILEQIIWDKEVEVSQRKARTPLSDVKAAAAAGLAPPPRDFLAAMRAARHRNGG
GVPALIAEVKKASPSKGLLRDHFDPVEIAQAYEKNGAACLSILTDEKHFQGSFENLEAVR
NSGVNCPLLCKEFVIDVWQIYYARSKGADAILLIAAVLPDIDITYFLRVCKSLGMTALVE
VHDEKELDRVLKIDGVELIGINNRSLGTFEVDTANTNMLLEKRGDIIKKKRIQVVSESGL
FTPDDVAYVQNAGVFAVLVGESLVTQEDPGQAIAGLFGKELLP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctccatcgccgctgccgccacctcggtcgtcgtcaggacaagcgttccggcc
gtcgtcttcatgccatcactctcctcgtcctcgtcctcctttcttagtcgtcccgccctc
cgcaccggtcgtcgtcgagccttccgctgcagcagcagcagcagcagcgtcgtcgccaag
caggactcggcgatatcgtcggcggcggccctgtactgcaggctggacgacaagctgttc
atgtcgccggaggtgttccagtgggagagcggcaagtccctgaacgccatcgcgtccgcg
cagggcatccagatccggcgccggtgccgcgccaggtacccctccgagggcaccggcgcc
gagcgcgccgtcccgcgcaacatcctggagcagatcatctgggacaaggaggtggaggtg
tcccagaggaaggcccggacgccgctcagcgacgtcaaggcggccgccgccgcggggctc
gcgccgccgcccagggacttcctcgcagcgatgcgcgcggcgcgccaccgcaacggcggc
ggcgtccctgcgctcatcgccgaggtcaagaaggcgtcgcccagcaagggccttctcagg
gaccatttcgatccggtggagatcgcgcaggcctacgagaagaatggcgcggcctgcctg
agcatcctgaccgacgagaagcacttccaggggagctttgagaacctggaggccgtacgc
aactctggtgtgaactgccctctgctgtgcaaggagtttgtcatagacgtctggcaaatc
tactacgcgcgttccaaaggcgccgacgcgatcctcttgatcgcggccgtgctaccggac
atcgacatcacctactttcttcgcgtttgcaagagtcttggaatgacagctcttgttgag
gttcatgatgagaaggagttggatcgcgtcctcaagatagatggtgttgagcttatcggc
atcaacaaccgcagtctagggacattcgaagtggatactgccaacacaaacatgttgttg
gagaaacgtggtgacatcatcaagaagaagcgaatacaggttgtgagcgagtctgggttg
ttcacccctgatgacgtggcatatgtacaaaatgctggggttttcgcagttttggtagga
gaatccctagtgacgcaggaagatcctggccaagcaattgctggattgttcgggaaagag
cttttaccttaa

DBGET integrated database retrieval system