KEGG   Sorghum bicolor (sorghum): SORBI_02g020430Help
Entry
SORBI_02g020430   CDS       T01086                                 

Gene name
SORBIDRAFT_02g020430, Sb02g020430
Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SORBI_02g020430 (SORBIDRAFT_02g020430)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SORBI_02g020430 (SORBIDRAFT_02g020430)
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SORBI_02g020430 (SORBIDRAFT_02g020430)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 403 aa AA seqDB search
MESSIAAAATSVVVRTSVPAVVFMPSLSSSSSSFLSRPALRTGRRRAFRCSSSSSSVVAK
QDSAISSAAALYCRLDDKLFMSPEVFQWESGKSLNAIASAQGIQIRRRCRARYPSEGTGA
ERAVPRNILEQIIWDKEVEVSQRKARTPLSDVKAAAAAGLAPPPRDFLAAMRAARHRNGG
GVPALIAEVKKASPSKGLLRDHFDPVEIAQAYEKNGAACLSILTDEKHFQGSFENLEAVR
NSGVNCPLLCKEFVIDVWQIYYARSKGADAILLIAAVLPDIDITYFLRVCKSLGMTALVE
VHDEKELDRVLKIDGVELIGINNRSLGTFEVDTANTNMLLEKRGDIIKKKRIQVVSESGL
FTPDDVAYVQNAGVFAVLVGESLVTQEDPGQAIAGLFGKELLP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctccatcgccgctgccgccacctcggtcgtcgtcaggacaagcgttccggcc
gtcgtcttcatgccatcactctcctcgtcctcgtcctcctttcttagtcgtcccgccctc
cgcaccggtcgtcgtcgagccttccgctgcagcagcagcagcagcagcgtcgtcgccaag
caggactcggcgatatcgtcggcggcggccctgtactgcaggctggacgacaagctgttc
atgtcgccggaggtgttccagtgggagagcggcaagtccctgaacgccatcgcgtccgcg
cagggcatccagatccggcgccggtgccgcgccaggtacccctccgagggcaccggcgcc
gagcgcgccgtcccgcgcaacatcctggagcagatcatctgggacaaggaggtggaggtg
tcccagaggaaggcccggacgccgctcagcgacgtcaaggcggccgccgccgcggggctc
gcgccgccgcccagggacttcctcgcagcgatgcgcgcggcgcgccaccgcaacggcggc
ggcgtccctgcgctcatcgccgaggtcaagaaggcgtcgcccagcaagggccttctcagg
gaccatttcgatccggtggagatcgcgcaggcctacgagaagaatggcgcggcctgcctg
agcatcctgaccgacgagaagcacttccaggggagctttgagaacctggaggccgtacgc
aactctggtgtgaactgccctctgctgtgcaaggagtttgtcatagacgtctggcaaatc
tactacgcgcgttccaaaggcgccgacgcgatcctcttgatcgcggccgtgctaccggac
atcgacatcacctactttcttcgcgtttgcaagagtcttggaatgacagctcttgttgag
gttcatgatgagaaggagttggatcgcgtcctcaagatagatggtgttgagcttatcggc
atcaacaaccgcagtctagggacattcgaagtggatactgccaacacaaacatgttgttg
gagaaacgtggtgacatcatcaagaagaagcgaatacaggttgtgagcgagtctgggttg
ttcacccctgatgacgtggcatatgtacaaaatgctggggttttcgcagttttggtagga
gaatccctagtgacgcaggaagatcctggccaagcaattgctggattgttcgggaaagag
cttttaccttaa

DBGET integrated database retrieval system