KEGG   Sorghum bicolor (sorghum): SORBI_02g020844Help
Entry
SORBI_02g020844   CDS       T01086                                 

Gene name
SORBIDRAFT_02g020844, Sb02g020844
Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SORBI_02g020844 (SORBIDRAFT_02g020844)
Enzymes [BR:sbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SORBI_02g020844 (SORBIDRAFT_02g020844)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 341 aa AA seqDB search
MVRVNSSSSAPGVNLTEQTENVFEQLISKIEPADFDPRPFLKQLNVLGRYEPIKRNVYCT
KRRVEDYGISCRCKPSPGSSVVCGRDCHCGMLFSCCSSQCECDNACTNKSFQHRPLKKTK
LIKTEKCGHGLVAEDEIKKGEFVIEYVGEVIDDRACENRLWTMKRLNDTDFYLCEVSSNM
VIDATNKGNLSRFINHSCEPNTKMQKWTVDGETRVGIFALRDIKIGEELTYDYKFVQFGA
AQVCHCGSSKCRKMLGTAKYSGSSQNHHAKKKKRKTNCENCIQQFLRLWHPQQRMYVGCW
IVDFDQETKMHTLQFIDLHTEKFDLKEEEWHFLEVDFDDED
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcgtgaactcgtcttcctcggcgcccggggtcaatctgacagagcaaaccgag
aatgtttttgagcaactgatcagcaagatagaacctgcagattttgatccgcggcccttt
ttgaaacaattgaacgtgttaggccgctacgaaccaatcaagcggaatgtatattgcact
aagagacgcgttgaagattatggcatttcttgtcgctgtaagccttctcctggttcatca
gttgtgtgtggcagagactgccattgtggcatgctcttctcttgctgttcatcacaatgt
gaatgtgataacgcgtgcaccaataaatcattccagcacagacctcttaagaaaaccaaa
ttgattaagacagagaaatgtggtcatggattggttgctgaagatgaaataaagaaagga
gaatttgttattgagtatgttggagaagttattgatgacagagcatgtgagaataggcta
tggacaatgaaaaggctgaatgacactgacttctacctttgtgaggtcagtagtaatatg
gtcatcgatgcaacaaacaagggaaacctgtcccgatttataaaccatagttgtgaacca
aacacaaagatgcagaaatggactgttgatggagagaccagggttgggattttcgcactt
cgtgacataaagataggggaggagctgacctatgactataaatttgtccagtttggagca
gctcaagtttgtcattgtggatcttcgaagtgcagaaaaatgctaggcacggcgaagtat
tcaggaagctcacagaatcatcatgccaagaagaaaaagaggaaaacaaactgtgagaat
tgcatacagcagtttcttcgtctgtggcatccacagcaaagaatgtatgttggatgttgg
atagttgactttgatcaagaaactaaaatgcatactctgcagttcattgatctccatact
gaaaagtttgatttgaaagaagaagaatggcacttcttagaggttgatttcgatgatgaa
gattga

DBGET integrated database retrieval system