KEGG   Sorghum bicolor (sorghum): SORBI_02g022640Help
Entry
SORBI_02g022640   CDS       T01086                                 

Gene name
SORBIDRAFT_02g022640, Sb02g022640
Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 465 aa AA seqDB search
MALKQKGTDAAATDTKKRRRVGFSGTDAGVEANECMKVFLVRNPDEVGSVDCTSIEPFDL
NHFFGEDGKIYGYKNLKINVWISAKSFHGYADISFDETSDGGKGITDLKPVLQNIFGENL
VEKEEFLHTFSKECECIRTAVTNGSAIKLDGSYESDPAVEIVRVELQGAAAFLYSRLVPL
VLLLVEGSTPIDIGEHGWEMVLVVKKTTQEAVSKFELLGFAAVHNFYHYPESTRLRISQI
LVLPPYQGEGHGLRLLEAINYIAQSENIYDVTIEDPSDYLQYVRSSIDCLRLLTFDPIKS
ALSAIVSSLKETNLSKRTHSLRMVPPAELMETVRQKLKINKKQFLRCWEILIFLSLDSQE
HKSMDNFRACIYDRIKGEILGSASGTNGKRLLQMVSSSNEESFAVYWTQESGDADDQTVE
QQPEDLKTQEQQLNELVDNQMEEIIGVAKNVTSRGKDKLVELVAQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaagcagaagggcaccgatgccgccgctaccgacaccaagaagcgccgccgc
gtcggcttctccggcaccgatgctggtgttgaggcaaatgagtgcatgaaagtatttcta
gtaaggaatccagatgaggtgggctctgtagactgcacttctattgagccgttcgatcta
aaccatttttttggtgaagatggaaagatatatggttacaaaaatcttaagataaatgtg
tggataagtgcaaaatcattccatggatatgctgatatttcatttgacgaaacgtctgat
ggagggaaaggaataacagatctaaagcctgttcttcagaacatttttggagaaaacttg
gtagaaaaagaagaatttctgcatacattttcgaaggaatgtgaatgtatcagaactgcc
gtgacaaatggtagtgccatcaagcttgatggctcatatgaatcagacccagcagttgag
attgttcgagttgaactccaaggtgctgctgcatttctttattctcgtctggtaccgctt
gttcttcttctggttgaaggttccacgcctatagatattggagaacatggatgggaaatg
gttttggtagtaaagaagacaacacaagaggctgtttcgaaatttgaactgctaggtttt
gcagctgtccataacttctatcattatcctgagagtactcgcttgcgaatcagccagata
cttgtcttgccaccttatcagggtgagggccatggtcttcgtcttcttgaagcaatcaat
tatattgcacagtctgagaacatatatgatgtaaccatagaagacccttctgactacctg
cagtatgtgcgctcatccattgactgcctccgtctcctcacgtttgatccgatcaaatct
gcactcagtgctattgtctcgtctctgaaggagaccaacctgtcaaaaaggactcacagt
ttgagaatggttccaccagctgagctgatggagactgtccgtcagaagctgaagatcaac
aagaaacagtttctccgatgctgggaaattctaatcttcctaagccttgactctcaggag
cataagagcatggacaacttcagggcctgcatatatgaccgcatcaagggggagatcctt
ggcagtgcctctggaactaatgggaagcgtctattgcagatggtaagcagttcaaatgag
gagtcttttgctgtgtattggacacaggagagtggggacgcagatgaccaaactgttgag
cagcagccagaagatctcaagactcaggagcagcagctcaatgagctcgtagacaaccaa
atggaggagattattggggttgctaagaacgtcacctcacgtggcaaggacaagctggta
gagctggtggcccaatga

DBGET integrated database retrieval system