KEGG   Sorghum bicolor (sorghum): SORBI_02g024040Help
Entry
SORBI_02g024040   CDS       T01086                                 

Gene name
SORBIDRAFT_02g024040, Sb02g024040
Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sbi00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sbi00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:sbi04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 509 aa AA seqDB search
MTRQNISKSLAVLLRARMQPNPIPSPPPPPPTDPDPAAPPVALVRHWLHASASAASPAPA
ALDSFSDGYRSLDLVGRREVLRSLAIDYDVPRARVRDLLRQYMSVASAEPSGGDDVEAEG
KEGAASALYRMERGLRDALRPRYAGFLEAMNAQPGGLKLLAVLRADLLALLGEENAPALR
ALDLYLKEKLVTWLSPAALTLHQITWDDPASLLEKIVAYEAVHPIRNLIDLKRRLGIGRR
CFGYFHPAIPGEPLIFIEVALLKDMAASIQEVLWDDPPTPESEASCALFYSISSTQPGLS
GINLGKFLLKRVIDMLRRDMPSVQIFATLSPIPGFMQWLLAKLASQIKLSEAESQEGNSL
GACSTFKESILLPDEERMIHDATEQADGKQGIELLQDILKSRQWVKSDKLSAALKRPLMR
LCARYLAREKKRGKALDAVANFHLQNGAMIERINWMADQSEKGIHQSGGIMVNYLYRLEN
IEEYALSYSSTGFIHSSPSLSEYLELKDL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacaagacagaacatatcgaagtcgctcgccgtcctcctccgcgcccgcatgcagccc
aaccccatcccctccccgccgccgccgccgcccacggaccccgaccccgccgccccgccc
gtggctctcgtccgccactggctccacgcgtctgcctccgccgcctccccggcccccgcg
gcgctcgacagcttctccgatgggtaccgctccctcgacctcgtcgggcgccgcgaggtc
ctccgttccctcgccatcgactacgatgtgccccgcgcgcgtgtccgggacctcttgaga
cagtacatgagcgtcgcctccgccgagccgtcaggcggggatgacgtggaggcggagggg
aaggagggcgccgcgtcggcgctgtaccggatggagcgggggctccgggacgcactccgg
ccccggtacgccgggttcctcgaggccatgaacgcgcagccaggcgggctcaagctcctc
gccgtgctccgcgccgatctcctcgccttgctgggggaggagaacgctccagcgctgcgg
gctctggacttgtacttgaaggagaagctggtgacttggcttagtcctgcggcactgacg
ctccaccagattacctgggatgatcctgcctccttgctagagaagattgtggcatatgaa
gctgtgcatccaatcaggaatctgatagacttgaagagaagattgggcattggccgccga
tgctttgggtacttccatccagcaataccaggggagcccctgattttcattgaagttgct
ttacttaaagatatggccgcatctatacaggaggtcttgtgggatgaccccccgactcct
gaatctgaagccagctgtgcactattttactcaatatcgtcaacccagcctggtttatca
ggtattaatctagggaagtttcttctcaagcgtgtgattgacatgttgagaagagatatg
ccatcagtacagatttttgcaacacttagtccaatccctggtttcatgcaatggcttctt
gctaagctggcctcccaaataaagttatcagaggcagaatcacaggaggggaattcacta
ggagcttgttctactttcaaagaatccatccttcttcctgacgaagagagaatgattcat
gatgccaccgaacaagctgatggaaagcaagggattgaactattgcaagatatactgaaa
tcaagacagtgggtaaagtctgacaaattatctgctgcattaaaacggcctcttatgcgt
ttatgtgcaaggtatcttgccagagagaagaagcgaggaaaagctctagatgctgttgca
aattttcacttgcaaaatggagcaatgattgaaagaataaattggatggccgaccaatca
gagaagggcattcatcaaagtggaggtatcatggtcaattatctttacaggttagagaac
atagaagagtatgcactatcatattcgagtacagggttcatccattcttcacctagcctg
tctgagtatctcgagctgaaggatttatga

DBGET integrated database retrieval system