KEGG   Sorghum bicolor (sorghum): SORBI_02g024040Help
Entry
SORBI_02g024040   CDS       T01086                                 

Gene name
SORBIDRAFT_02g024040, Sb02g024040
Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SORBI_02g024040 (SORBIDRAFT_02g024040)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SORBI_02g024040 (SORBIDRAFT_02g024040)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    SORBI_02g024040 (SORBIDRAFT_02g024040)
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     SORBI_02g024040 (SORBIDRAFT_02g024040)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 509 aa AA seqDB search
MTRQNISKSLAVLLRARMQPNPIPSPPPPPPTDPDPAAPPVALVRHWLHASASAASPAPA
ALDSFSDGYRSLDLVGRREVLRSLAIDYDVPRARVRDLLRQYMSVASAEPSGGDDVEAEG
KEGAASALYRMERGLRDALRPRYAGFLEAMNAQPGGLKLLAVLRADLLALLGEENAPALR
ALDLYLKEKLVTWLSPAALTLHQITWDDPASLLEKIVAYEAVHPIRNLIDLKRRLGIGRR
CFGYFHPAIPGEPLIFIEVALLKDMAASIQEVLWDDPPTPESEASCALFYSISSTQPGLS
GINLGKFLLKRVIDMLRRDMPSVQIFATLSPIPGFMQWLLAKLASQIKLSEAESQEGNSL
GACSTFKESILLPDEERMIHDATEQADGKQGIELLQDILKSRQWVKSDKLSAALKRPLMR
LCARYLAREKKRGKALDAVANFHLQNGAMIERINWMADQSEKGIHQSGGIMVNYLYRLEN
IEEYALSYSSTGFIHSSPSLSEYLELKDL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacaagacagaacatatcgaagtcgctcgccgtcctcctccgcgcccgcatgcagccc
aaccccatcccctccccgccgccgccgccgcccacggaccccgaccccgccgccccgccc
gtggctctcgtccgccactggctccacgcgtctgcctccgccgcctccccggcccccgcg
gcgctcgacagcttctccgatgggtaccgctccctcgacctcgtcgggcgccgcgaggtc
ctccgttccctcgccatcgactacgatgtgccccgcgcgcgtgtccgggacctcttgaga
cagtacatgagcgtcgcctccgccgagccgtcaggcggggatgacgtggaggcggagggg
aaggagggcgccgcgtcggcgctgtaccggatggagcgggggctccgggacgcactccgg
ccccggtacgccgggttcctcgaggccatgaacgcgcagccaggcgggctcaagctcctc
gccgtgctccgcgccgatctcctcgccttgctgggggaggagaacgctccagcgctgcgg
gctctggacttgtacttgaaggagaagctggtgacttggcttagtcctgcggcactgacg
ctccaccagattacctgggatgatcctgcctccttgctagagaagattgtggcatatgaa
gctgtgcatccaatcaggaatctgatagacttgaagagaagattgggcattggccgccga
tgctttgggtacttccatccagcaataccaggggagcccctgattttcattgaagttgct
ttacttaaagatatggccgcatctatacaggaggtcttgtgggatgaccccccgactcct
gaatctgaagccagctgtgcactattttactcaatatcgtcaacccagcctggtttatca
ggtattaatctagggaagtttcttctcaagcgtgtgattgacatgttgagaagagatatg
ccatcagtacagatttttgcaacacttagtccaatccctggtttcatgcaatggcttctt
gctaagctggcctcccaaataaagttatcagaggcagaatcacaggaggggaattcacta
ggagcttgttctactttcaaagaatccatccttcttcctgacgaagagagaatgattcat
gatgccaccgaacaagctgatggaaagcaagggattgaactattgcaagatatactgaaa
tcaagacagtgggtaaagtctgacaaattatctgctgcattaaaacggcctcttatgcgt
ttatgtgcaaggtatcttgccagagagaagaagcgaggaaaagctctagatgctgttgca
aattttcacttgcaaaatggagcaatgattgaaagaataaattggatggccgaccaatca
gagaagggcattcatcaaagtggaggtatcatggtcaattatctttacaggttagagaac
atagaagagtatgcactatcatattcgagtacagggttcatccattcttcacctagcctg
tctgagtatctcgagctgaaggatttatga

DBGET integrated database retrieval system