KEGG   Sorghum bicolor (sorghum): SORBI_02g025410Help
Entry
SORBI_02g025410   CDS       T01086                                 

Gene name
SORBIDRAFT_02g025410, Sb02g025410
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SORBI_02g025410 (SORBIDRAFT_02g025410)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 153 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPATEKAEKAPAGKKPKAEKRLPAGKSAGKEGGEGKKGKKKAK
KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAESAKLARYNKKPTITS
REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaggcggagaagaagccggcggcgaagaagcccgcggaggaggagcccgcg
accgagaaggcggagaaggccccggcggggaagaagcccaaggccgagaagcggctcccc
gcgggcaagtccgccggcaaggagggcggcgagggcaagaaggggaagaagaaggcgaag
aagtccgtggagacctacaagatctacatcttcaaggtgctcaagcaggtgcacccggac
atcggcatctcgtccaaggccatgtccatcatgaactccttcatcaacgacatcttcgag
aagcttgcggccgagtccgccaagctggcgcgctacaacaagaagcccaccatcacctcc
cgcgagatccagacctcggtgcgcctcgtcctccccggcgagctcgccaagcacgccgtc
tccgagggcaccaaggctgtcaccaagttcacctcttcttag

DBGET integrated database retrieval system