KEGG   Sorghum bicolor (sorghum): SORBI_02g029180Help
Entry
SORBI_02g029180   CDS       T01086                                 

Gene name
SORBIDRAFT_02g029180, Sb02g029180
Definition
hypothetical protein
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SORBI_02g029180 (SORBIDRAFT_02g029180)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SORBI_02g029180 (SORBIDRAFT_02g029180)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 1059 aa AA seqDB search
MGKKVKAKPKNSRKAHERDLPASSSEVGPGDAASQDASHSAEEAAASASGREHCGHYGHD
NAHLDKVLLEILSSKHVASCEHCREDAPRKKGGAVGKQKKKGGTSKGATAKAQAKADKSD
TWVCLDCGRHFCGGAVVDTKPYGHARRHAKQDRHWWAARYDDPTVAYCLSCEKEVSIEMP
KLETVVAAAVEDKVVDAEDTDSWRLINPDANVIKGLPNLGNTCFFNAVLQSLLAVDRLRR
KMLGPDVRTGALAMSLKKLFAETSASNHAGGALSPKNLFSSICSKYPQFRGYQMQDSHEL
LRCFLDGLRTEETEARKLEEEASDAGVPTIVDSIFGGQLSSTVSSTECSHSSVKHDQFLD
LSLPVPSRRPPTKSVSSPPAKRTKQSIRDRNKSRRYGKVPARASPSVESKEQIQTIAERN
NSQIPGSELEQVVSVSEKEAEPSGCSESCGSVSNQEQNATTNVENSICWLDYVADVDETK
SEILDSADSTGTGQIWECRDATDGPLHPQDDALPKEQILGSEHSGENTVDDDASLQTVIL
LPYKELGTTAKERDETIENSYNSECEVPPLVVVSPVTENNTQPGYCGDVEQDDYIGLGDM
FNEPEVTSEVKKEASKVEDIDVMAWSSNSADDEVDDSNAPVSVEGCLALYTEPELLSEPW
LCEHCTNAARIKVDERKNVMEMTDGANEIKDGEEMMAGGDGRKDGKKLIVSCSKQEGIDQ
VMGTDGCKKDIDQIMATVDCSDNVHSDMHCKEARCVNTSLADPQQNCDCNFPDTENTSMQ
RSGALFTMNETEQSSNETSHKEQCMDLKRLELESSSLNNQHDSPIQYNDGHNVDITAKAA
SAPLSCGGESESCNATNNVEAPPVGDTEEVVSSSLPSDAQKTLLGAKDNEDAITKNQGRR
KRMKMVGKAQLEQDNQNKQKDDETKVFRAALRRILISKAPPVLTINLNRFSQDSHGRYKK
LKGHVRFKEMLDIQPFMDPRCNENTTSTYRLVGVVEHLGTMTGGHYIAYVRACKIGGRQQ
QSSGSKSWFYASDGQVREASLEEVLNCEAYILFYERVGD
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaggtgaaggctaagcccaagaactcgcggaaagcgcatgaacgggatctt
ccagcctcatcctcggaggttggacctggtgatgcggcatcgcaggatgcaagccactca
gcagaggaagcagctgcttcagctagtggccgggagcattgcggccactacggtcatgac
aatgctcacttggacaaggtcctcctggagatcttgtcttccaagcatgttgcgtcatgt
gagcactgccgagaagatgccccaagaaagaaaggtggtgctgtgggtaagcagaagaag
aaaggaggcacctccaaaggcgctactgccaaggcgcaggcgaaggcggataaaagtgat
acgtgggtctgcttggactgtggtcggcatttttgtggtggtgcagtagtggataccaag
ccctatggccatgccagacggcatgctaagcaggaccggcattggtgggctgcaaggtat
gatgacccaacagttgcttattgtttgtcatgtgaaaaggaggtgtcaattgagatgccc
aaattagagacagttgttgcagcagcagtggaagataaggtggttgatgcagaggatact
gattcatggcgtttgattaaccccgatgctaatgtgatcaaagggctgccgaatctggga
aatacatgtttcttcaatgcagtgctgcagagcctcctcgcggttgataggctgcgcagg
aagatgttaggaccagacgttcgtacgggggcccttgctatgtcactgaagaagcttttt
gcagagacaagtgcttcaaatcatgcaggaggtgcgctaagcccgaagaacctcttctca
agcatttgctcaaaatatccacagtttaggggctaccagatgcaggatagccatgaattg
ctccgttgttttcttgatggtttgcgtacagaggaaactgaagcacggaagctagaggag
gaagcttcagatgcaggggttcccacaattgtggattccatttttgggggtcagctgtct
agtactgtgtccagcacagaatgctcacacagttctgttaaacatgatcaattccttgat
ctctcactaccagttccatcaaggaggcctccaaccaagagtgtttcatcaccaccagca
aagaggaccaaacaatccatacgagataggaataaaagccgcagatatgggaaggttcca
gctcgagcatctccttcagtagagagtaaagaacagatccaaacaattgctgagcgtaac
aattcccaaattcctggttcagaactcgaacaggtagtcagcgtcagcgagaaagaggct
gagccctctggatgcagtgagtcatgtggttctgtgtctaatcaagaacaaaatgccact
acaaatgtggagaatagcatctgctggttggattatgtcgccgatgtggatgaaacaaaa
tccgagattcttgattctgcagattctactggaacaggacaaatttgggaatgcagggat
gcaacagatggtcccttgcaccctcaggatgatgctctacccaaagagcagatcttgggt
tctgagcactcaggcgagaacactgttgatgatgatgcctccttacagactgttatctta
cttccttacaaagaacttggtaccactgccaaggaaagggatgaaaccattgaaaattca
tataattcagaatgtgaagttcctcctctagttgttgtttctccagtaacggaaaataat
acacaacctggatattgtggagatgtggagcaagatgactatattggtcttggtgatatg
ttcaatgaaccggaagttacttctgaagtcaagaaagaagctagcaaagtagaagatatt
gatgtaatggcttggagtagtaacagtgctgatgatgaggtagatgatagtaatgctcct
gtatcagttgagggctgcttggctttgtatactgaaccagagctgctgtctgaaccatgg
ctgtgtgagcactgcactaatgctgcacgcataaaagttgatgaaagaaaaaatgtcatg
gagatgactgacggagctaatgaaataaaggatggtgaggagatgatggcaggtggtgat
ggaagaaaagatggtaagaagttgatcgtgagctgcagcaaacaggagggcattgatcag
gttatgggaactgatggttgcaaaaaggacattgatcagattatggcaactgttgattgc
tctgacaatgtacattctgatatgcattgcaaggaagctaggtgtgttaatacttctttg
gctgaccctcaacaaaactgtgattgtaattttccagacacagaaaatacttctatgcag
agatctggtgcactcttcactatgaatgagactgaacagtcaagcaatgagaccagccac
aaggaacagtgtatggatttgaaaagattagaacttgagtcctcatctttgaataaccaa
catgattcacctatccaatataatgatggtcataatgtggatataaccgctaaagcagca
agtgcaccactgagttgtggtggtgaatccgagtcttgcaatgcaactaacaatgttgaa
gctccacctgttggtgatactgaagaagttgtgtcgagtagccttccatcagatgcacaa
aaaaccttgcttggtgcaaaagataatgaagatgccatcacaaagaatcagggcaggagg
aagcgaatgaagatggttggtaaggcacagttagagcaagataaccaaaataagcagaaa
gatgatgagacaaaggttttcagagctgcattgagaagaattcttataagcaaggctcca
cctgtattgacgattaacttgaacagattcagccaagattctcatggtcgatataaaaaa
ctgaaaggacatgtgcgctttaaggagatgcttgatatacaaccattcatggacccaaga
tgtaacgagaacaccaccagcacctatcgtcttgttggtgttgtcgagcacttgggaacc
atgacgggaggtcattatattgcgtatgtgagagcttgcaagattggaggtcggcagcag
cagagcagtggctcaaagtcttggttttatgcaagcgatggacaagtcagagaagcctct
ctggaagaagtgctgaactgtgaggcttacattctcttttatgagagggtgggcgactaa

DBGET integrated database retrieval system