KEGG   Sorghum bicolor (sorghum): SORBI_02g031030Help
Entry
SORBI_02g031030   CDS       T01086                                 

Gene name
SORBIDRAFT_02g031030, Sb02g031030
Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_02g031030 (SORBIDRAFT_02g031030)
   01230 Biosynthesis of amino acids
    SORBI_02g031030 (SORBIDRAFT_02g031030)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_02g031030 (SORBIDRAFT_02g031030)
   00051 Fructose and mannose metabolism
    SORBI_02g031030 (SORBIDRAFT_02g031030)
   00562 Inositol phosphate metabolism
    SORBI_02g031030 (SORBIDRAFT_02g031030)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SORBI_02g031030 (SORBIDRAFT_02g031030)
Enzymes [BR:sbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SORBI_02g031030 (SORBIDRAFT_02g031030)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SORBI_02g031030 (SORBIDRAFT_02g031030)
  Exosomal proteins of bladder cancer cells
   SORBI_02g031030 (SORBIDRAFT_02g031030)
  Exosomal proteins of melanoma cells
   SORBI_02g031030 (SORBIDRAFT_02g031030)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 304 aa AA seqDB search
MAAAPSSLASSHLSRLADLRRAAAVATPAVPQQLRIGCSRRRAQRVVAMAGSGKFFVGGN
WKCNGTKDSISKLVSELNAATLETDVDVVVAPPFIYIDQVKNSLTGRIEVSAQNVWIGKG
GAYTGEISAEQLVDIGVQWVILGHSERRHIIGEDDEFIGKKAAYALSQNVKLIACIGELL
EEREAGKTFDVCFTQMKAFADSISNWADVVIAYEPVWAIGTGKVATPEQAQEVHAAVRDW
LKTNVSPEVASSTRIIYGGSVNAANCAELAKKEDIDGFLVGGASLKAPDFATIVNSVTAK
KVTA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgccgtcgtccctcgcgtcctcccacctctcccgcctcgccgacctccgc
cgcgccgcggcggtggccactcccgccgtcccacagcagcttcgcatcggctgctcgcgc
cgccgcgcccagcgcgtcgtcgccatggctggatccggcaagttcttcgtcggaggcaac
tggaagtgcaatggaacaaaggactccattagcaagcttgtttctgaattgaatgctgct
accctcgaaactgatgtagatgttgtggtggcacctccattcatctatatcgatcaggtc
aagaattcactaactggtcgcattgaggtttctgctcagaatgtgtggattggaaaagga
ggagcctacaccggagagatcagtgcagaacaattggtggacattggtgttcagtgggtt
attcttggacactctgagcgtaggcatattattggtgaagatgatgagtttattgggaag
aaggctgcatatgcattgagccaaaatgttaagcttattgcctgcataggagagctcctg
gaagagagggaagcagggaaaacttttgatgtatgttttacgcagatgaaggcttttgca
gatagtatttcaaactgggccgatgttgtaattgcatatgagcctgtttgggctattgga
actggaaaagttgctactcctgagcaggcccaggaagttcatgccgctgtacgcgattgg
ttgaagaccaacgtatcacctgaagttgcctctagcactcgaataatctatggaggttct
gtgaatgcagccaattgtgcagagctagcaaagaaagaagatattgatggttttcttgtt
ggcggtgcctccttgaaggcaccggatttcgccaccattgtcaactcagtgactgccaag
aaagttactgcgtga

DBGET integrated database retrieval system