KEGG   Sorghum bicolor (sorghum): SORBI_02g031570Help
Entry
SORBI_02g031570   CDS       T01086                                 

Gene name
SORBIDRAFT_02g031570, Sb02g031570
Definition
hypothetical protein
Orthology
K01581  
ornithine decarboxylase [EC:4.1.1.17]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SORBI_02g031570 (SORBIDRAFT_02g031570)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SORBI_02g031570 (SORBIDRAFT_02g031570)
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     SORBI_02g031570 (SORBIDRAFT_02g031570)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 413 aa AA seqDB search
MVGSSPVQAVLAAPGVRDRKVLAFKSDAHKGNKQDVASGLVHSILASTSPPQRSAFYVLD
LAKVVDLFRAWRRALPDARPCYAVKCNPDPALLGALAALGAGFDCASRAEIEAVLALGVQ
PRDIVYANPCKPEAHLEYAAEVGVNLTTYDSEEEVAKVRRCHPACELLLRLKGPDGGGVR
VDLGTKYGAHADEVVPLLRAAQRAGVGVAGVSFHVGSGASILAVYSGAIQAARAAFDAAA
ALGMPPMRVLDIGGGFVSGPTFDDAAAVINDALAQHFGDLPCVEVIGEPGRYFAETAFTL
AARVIGKRTRGEVREYWIDDGLYGSLNCVIMDHYVPTPRPLASPRPGDKTYTSTVFGPTC
DSFDTVVTGYQLPEMSVGDWLVFDDMGAYTTGAGSNFNGYATSDIKIYVAYSS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggttggaagcagccccgtgcaggccgtgctggcggcgcccggcgtcagggacaggaag
gtgctcgcgttcaaaagcgacgcccacaagggcaacaagcaggacgtcgcgtccggcctc
gtccactccatcctcgcctccaccagcccgccccagcgcagcgccttctacgtcctcgac
ctcgccaaggtcgtcgacctcttccgcgcgtggcgccgggcgctccccgacgcgcggccc
tgctacgccgtcaagtgcaacccggacccggcgctcctgggcgcgctcgccgcgctcggc
gcgggcttcgactgcgccagccgcgccgagatcgaggccgtgctcgcgctcggcgtccag
ccccgggacatcgtctacgccaacccctgcaagcccgaggcgcacctcgagtacgccgcg
gaggtcggcgtcaacctcaccacctacgactccgaggaggaggtggccaaggtcaggcgc
tgccacccggcctgcgagctcctgctccgcctcaagggccccgacggcggcggcgtcagg
gtcgacctgggcaccaagtacggcgcgcacgccgacgaggtcgtgccgctcctgcgcgcc
gcgcagcgcgcgggggtcggcgtggccggcgtctccttccacgtcggcagcggcgcgtcc
atcctcgccgtgtacagcggggccatccaggccgcgcgcgccgcgttcgacgccgccgcc
gccctggggatgccgcccatgcgcgtcctcgacatcggcggcgggttcgtgtccggcccc
actttcgacgacgcggcggcggtgatcaacgacgcgctcgcgcagcacttcggcgacctg
ccgtgcgtggaggtgatcggcgagcccgggcggtacttcgccgagacggccttcacgctc
gccgcgcgcgtcatcgggaagcgcacgcgtggagaggtgcgcgagtactggatcgacgac
ggcctctacggctcgctcaactgcgtcatcatggaccactacgtgccgacaccgaggccg
ctagccagcccgcgccccggcgacaaaacctacacttccacggtgttcggaccaacgtgc
gactctttcgacacggtggtgaccgggtaccagctgccagagatgagcgtgggcgactgg
ctcgtcttcgacgacatgggcgcctacaccaccggagccggctccaacttcaacggctac
gcgacgtcagacataaagatctacgtagcctactccagctga

DBGET integrated database retrieval system