KEGG   Sorghum bicolor (sorghum): SORBI_02g032250Help
Entry
SORBI_02g032250   CDS       T01086                                 

Gene name
SORBIDRAFT_02g032250, Sb02g032250
Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SORBI_02g032250 (SORBIDRAFT_02g032250)
   00052 Galactose metabolism
    SORBI_02g032250 (SORBIDRAFT_02g032250)
   00500 Starch and sucrose metabolism
    SORBI_02g032250 (SORBIDRAFT_02g032250)
   00520 Amino sugar and nucleotide sugar metabolism
    SORBI_02g032250 (SORBIDRAFT_02g032250)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SORBI_02g032250 (SORBIDRAFT_02g032250)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 462 aa AA seqDB search
MAAAAAAAVSVDEKLDKLRAEVAKLDQISENEKSGFLSLVSRYLSGEAEQIEWSKIQTPT
DEVVVPYDTLASPPEDLEETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDL
IVIQIESLNKKYGCSVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDF
LPLPSKGNSGKDGWYPPGHGDVFPSLNNSGKLDILLAQGKEYVFVANSDNLGAIVDIKRV
TPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLKAIKRL
VEAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDKAIGINVPRSRFLPVKATSDLLL
VQSDLYTLVDGFVIRNPARANPANPSIELGPEFKKVANFLARFKSIPSIVELDNLKVSGD
VWFGSGITLKGKVTITAKSGVKLEIPDGAVLENKDVNGPEDL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgccgccgctgccgcggtgtcggtcgacgagaagctcgacaagcttcgcgcc
gaggtcgccaagctcgaccagatcagcgagaacgagaagtccgggttcctcagcctcgtg
tcacgctacctcagtggggaggcggagcagatcgagtggagcaagatccagaccccgact
gatgaggtggtggtgccgtacgataccctcgcgtcgcctcccgaagatctcgaggagacg
aagaagctgctggacaagctcgttgtgctcaagcttaacggagggctcgggacgaccatg
ggctgcactgggcccaagtctgtcattgaagtccgcaatgggttcacattccttgatctt
attgtgatccaaattgagtccctgaacaagaagtatggatgcagtgtccctttacttctg
atgaactctttcaacacccatgatgacacacagaagattgttgaaaagtattccaactcc
aacattgaaattcatactttcaatcagagccagtatcctcgcattgttaccgaggacttc
ttgccacttccaagcaaagggaactctgggaaggatggctggtatcctccaggccatggt
gatgtgttcccctctctgaataacagcggaaaacttgacatcttattggctcagggcaag
gagtatgtcttcgttgcaaactcagacaacttgggtgctatagtcgacatcaaacgagtt
actccaaagacgctggctgatgttaagggcggtacactcatctcttacgaaggaagagtt
cagcttttggagattgcccaagtacctgatgagcatgtcaatgaatttaaatcaatcgag
aagtttaagatattcaacactaacaacttgtgggtgaaccttaaagctatcaagagactc
gtagaggctgaggctcttaagatggaaattattccaaaccccaaggaagttgatggtgta
aaggtccttcaactcgaaactgcagctggtgcagctattcggttcttcgacaaagcgatt
ggaattaatgttccccgctcaaggtttctcccagtgaaggctacatctgatttgttgctt
gtgcagtctgatctttacaccttggttgatggctttgtcatccgcaacccagccagagcg
aatccagctaacccttcgattgagcttggacctgagttcaagaaggttgccaatttcctt
gctcggttcaagtccatccccagcatcgtcgagcttgacaacttgaaggtttctggtgat
gtctggtttggctctggaattacactcaagggcaaggtgacaatcactgccaagtctgga
gtgaagttggagattccagatggagctgtacttgagaacaaggatgtcaatggccctgag
gatctttaa

DBGET integrated database retrieval system