KEGG   Sorghum bicolor (sorghum): SORBI_02g035150Help
Entry
SORBI_02g035150   CDS       T01086                                 

Gene name
SORBIDRAFT_02g035150, Sb02g035150
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_02g035150 (SORBIDRAFT_02g035150)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SORBI_02g035150 (SORBIDRAFT_02g035150)
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SORBI_02g035150 (SORBIDRAFT_02g035150)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 574 aa AA seqDB search
MPSPFSVPSLIMEEEGRFEAEVAEVESWWTTERFRLTKRPYTARDVVLLRGTLRQSYASG
EMAKKLWRTLKAHQAGGTASRTFGALDPVQVTMMAKHLDTIYVSGWQCSSTHTSTNEPGP
DLADYPYDTVPNKVEHLFFAQLYHDRKQREARMSLPRADRARAPYVDFLKPIIADGDTGF
GGATATVKLCKLFVERGAAGVHLEDQSSVTKKCGHMAGKVLVAVSEHVNRLVAARLQFDV
MGVETVLVARTDAVAATLIQTNVDARDHQFILGATNPRLRGQSLAAVLSDGMAAGKNGRE
LQAIEDEWLAAAQLKTFSDCVRDAIAGLAVSAQEKQRRVQEWDRATGAGGYDRCVSNEQA
RDIAAGLGVASVFWDWDLPRTREGFYRFRGSVGAAVVRGRAFAPHADVLWMETSSPNVAE
CTAFAEGVKAACPEAMLAYNLSPSFNWDASGMTDAEMAAFIPSVARLGYVWQFITLAGFH
ADALVTDTFARDFARRGMLAYVERIQREERINGVETLEHQKWSGANFYDRVLKTVQGGIS
STAAMGKGVTEEQFKDSRPATGSSGLQVMAKSRI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgccgttctccgtcccctcgctgatcatggaggaggaagggcggttcgaggcg
gaggtggcggaagtggagtcatggtggacgacggagcggttccggctcaccaagcgcccc
tacaccgcccgcgacgtggtcctcctccggggcacgctccgccagagctacgcgtcgggg
gagatggccaagaagctgtggcgcacgctcaaggcgcaccaggccgggggcacggcgtcc
cgcaccttcggcgcgctggaccccgtccaggtcaccatgatggccaagcacctggacacc
atctacgtctccggctggcagtgctcctccacgcacacctccaccaacgagcccggcccg
gacctcgccgactacccctacgacaccgtgcccaacaaggtggagcacctcttcttcgcg
cagctctaccacgaccgcaagcagcgggaggcgcgcatgtcgctgccccgcgccgaccgg
gccagggcgccctacgtcgacttcctcaagcccatcatcgccgacggcgacaccgggttc
ggcggcgccacggccaccgtcaagctctgcaagctcttcgtcgagcgcggggcggcgggc
gtccacctcgaggaccagtcgtcggtcaccaagaagtgcgggcacatggccgggaaggtg
ctcgtcgcggtgtcggagcacgtcaaccgcctcgtcgccgcgcggctccagttcgacgtc
atgggcgtcgagaccgtcctcgtcgcgcgcaccgacgccgtcgccgccacgctgatccag
accaacgtcgacgcgcgcgaccaccagttcatcctcggcgccaccaacccgcgcctgagg
ggacagagcctggcggccgtgctgtcggacggcatggcggcgggcaagaacggcagggag
ctgcaggccatcgaggacgagtggctcgccgcggcgcagctcaagaccttctccgactgc
gtcagggacgccatcgcggggctcgccgtctccgcccaggagaagcagcgcagggtccag
gagtgggaccgcgccaccggcgctggcggctacgacaggtgcgtgtccaacgagcaggcg
cgcgacatcgccgcggggctcggcgtcgcgtccgtgttctgggactgggacctcccgcgg
accagggaagggttctaccggttccggggctccgtgggcgccgccgtggtccggggccgc
gccttcgcgccgcacgccgacgtgctgtggatggagacgtccagccccaacgtggccgag
tgcaccgccttcgccgagggcgtcaaggcggcgtgcccggaggcgatgctggcctacaac
ctctcgccgtccttcaactgggacgcctccgggatgacggacgccgagatggcggccttc
atccccagcgtcgcacgcctcgggtacgtctggcagttcatcacgctcgccgggttccac
gccgacgcgctcgtcaccgacacgttcgcgcgggacttcgcgcggcggggcatgctggcc
tacgtggagaggatccagagggaggagaggatcaacggcgtggagacgctggagcaccag
aagtggtcgggcgccaatttctatgacagggtgctcaagacggtgcagggtggcatctcc
tcaactgcagccatgggcaaaggagttactgaagagcaattcaaggattcaaggccggca
actgggagcagtggcctgcaagttatggccaaatccaggatttga

DBGET integrated database retrieval system