KEGG   Sorghum bicolor (sorghum): SORBI_02g037280Help
Entry
SORBI_02g037280   CDS       T01086                                 

Gene name
SORBIDRAFT_02g037280, Sb02g037280
Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SORBI_02g037280 (SORBIDRAFT_02g037280)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    SORBI_02g037280 (SORBIDRAFT_02g037280)
   00603 Glycosphingolipid biosynthesis - globo series
    SORBI_02g037280 (SORBIDRAFT_02g037280)
   00604 Glycosphingolipid biosynthesis - ganglio series
    SORBI_02g037280 (SORBIDRAFT_02g037280)
   00511 Other glycan degradation
    SORBI_02g037280 (SORBIDRAFT_02g037280)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SORBI_02g037280 (SORBIDRAFT_02g037280)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 584 aa AA seqDB search
MATLLLQLLFLLGWPVTLLTCAAAGASFPVNVWPKPTSMSWAEPHSAVPVSPSFHIVASS
GNPYLVSAAERYAKLLFKETYRPIVRPAVNVTAGNALETLTLAVSDLAAPLQHGVDESYT
LEILPTGAATVTAVTAWGAMRGLETFSQLSWRAGGRGRSRSRDLLLVAAGVRVEDRPLYP
HRGLMLDTGRTYFPVSDILRTIDAMAANKMNVFHWHITDSQSFPIVLPSEPSLAEKGAYG
EDMVYTVEDVKRIVEFAMSRGVRVVPEIDSPGHTASWAGAYPEAVTCAGKFWLPDGDWNN
RLAAEPGAGQLNPLAPKTYEVITNVVNDLTSLFPDGFYHAGADEVTPGCWQADATIQADL
ERGGTLSQLLERYVSAVHPLVVSKNRTAVYWEDVLLDAAVNVSASLIPPATTILQSWNNG
ANNTKLIVQAGYRAIVSSASFYYLDCGHGDFVGNNSIYDDPNSDYDTDGGSWCGPYKTWQ
RVYDYDITYGLTAEEAQLVIGGEVAMWTEQVDTAVLDGRVWPRASAMAEALWSGNRDASG
RKRYAEATDRLIDWRQRMVGRGIRAEPIQPLWCRTRPGMCNAVQ
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgctcctccttcagctgctgttcttgctcggctggccggtgacgctcctgacg
tgcgcggccgcgggcgcgtcgttccccgtcaatgtgtggcccaagccgacgtccatgtcg
tgggcggagccgcactcggccgttccggtgtcgccgtcgttccacatcgtcgcgtcgtcg
ggtaacccgtacctcgtgtcggccgcggagcgctacgccaagctgctgttcaaggagacg
taccgccccatcgttcggccggcggtcaacgtcaccgcggggaacgcgctggagacgctg
acgctggcggtgtccgacctcgctgccccgctgcagcacggcgtggatgagtcctacacg
ctggagatcctccccacgggcgcggccacggtgaccgcggtcaccgcgtggggcgccatg
cgcgggctggagacgttctcgcagctgtcgtggcgggccggaggccggggccggagccgg
agccgggacctgctgctggtggccgccggcgtgcgcgtcgaggaccggcccctgtacccg
caccgtgggctgatgctcgacaccgggaggacctacttccccgtgtccgacatcctgcgg
accatcgacgccatggcggccaacaagatgaacgtgttccactggcacatcacggactcg
cagtcgttccccatcgtgctgccctccgagccgtctctcgccgagaagggcgcctacgga
gaggacatggtgtacaccgtcgaggacgtcaagcgcatcgtcgagttcgccatgagccgc
ggcgtccgcgtcgtgccggagatagactcgccgggccacacggcttcatgggccggcgcg
tacccggaggccgtgacctgcgcgggcaagttctggctgcccgacggcgactggaacaac
cgtctcgccgccgagccgggcgccggccagctgaacccgctggcgcccaagacgtacgag
gtgatcaccaacgtggtgaacgacctgacctccctgttcccggacggcttctaccacgcc
ggcgccgacgaggtcaccccgggctgctggcaggcggacgccacgatccaggcggacctg
gagcgcggcggcacgctgagccagctcctggagcggtacgtgagcgcggtgcacccgctg
gtggtgtccaagaaccgcaccgccgtgtactgggaggacgtgctgctggacgcggccgtg
aacgtgagcgcgtcgctgatcccgccggccaccaccatcctgcagtcgtggaacaacggc
gccaacaacaccaagctcatcgtgcaggccgggtaccgcgccatcgtctcctccgcctcc
ttctactacctcgactgcggccacggcgacttcgtcggcaacaacagcatctacgacgac
cccaacagcgactacgacaccgacggcggttcctggtgcgggccgtacaagacgtggcag
cgggtgtacgactacgacatcacgtacgggctcaccgccgaggaggcccagctggtcatc
ggcggcgaggtggcaatgtggacggagcaggtcgacacggccgttctggacggccgggtc
tggccgagggcgtcggccatggcggaggcgctctggtctggcaaccgcgacgcgtcgggc
aggaagaggtacgccgaggccaccgaccggctcatcgactggaggcagcgcatggtgggg
agggggatccgggccgagcccatccagccgctttggtgccgaacacgccccggaatgtgc
aacgcggtccagtaa

DBGET integrated database retrieval system