KEGG   Sorghum bicolor (sorghum): SORBI_02g038550Help
Entry
SORBI_02g038550   CDS       T01086                                 

Gene name
SORBIDRAFT_02g038550, Sb02g038550
Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SORBI_02g038550 (SORBIDRAFT_02g038550)
Protein phosphatases and associated proteins [BR:sbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SORBI_02g038550 (SORBIDRAFT_02g038550)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 703 aa AA seqDB search
MSAPAPAPAPPMAAPRVGLLYDDRMRAHATPDGEEHPENPERLRAIWRKLNAEGVAPRCV
ALKAKEAEDKYIASVHSKSHIKLMKEISSKKYDATRNKIARKFNSIYFNKGSSESAVLAA
GSVIEVAEKVAAGELSSAIALVRPPGHHAEHDEAMGFCLFNNVAVAANYLLNERPDLGIK
KILIVDWDVHHGNGTQKMFYNDPRVLFFSVHRFDYGSFYPAEGDASHCFIGEEGGKGYNI
NVPWEHGKCGDADYIAAWDHVLLPVTKVFDPDIILVSAGFDAALGDPLGGCCITPNGYAL
LLTKLLGFAQGRIVMALEGGYNLRSIANSVCACAKVLLGDKFTFNAPEMQPFESTWSVIQ
AVRNELKTCWPVLSSKLPENVSLRIRPSPSEVNASSDSESDSEDVAELLPTVASVNVIEV
AGDAISEHLSKMKLDDDNLSVKTTSSCSAAEQHLVDSVKVQNNASVVLTKKISDLSLAWR
SDLSRTDVWYASFGSNMWRPRFLCYVQGGKAEGMSIACYGSRDTSSPKGTMWKTVPHRLL
FGRSSTPCWGTGGVAFLNPEINYNEKSYVCMYKITLEQFNDILFQENRLVLKDGKDGNVV
YPDSPLIGSSEIKFISTNKAIHLEPIKDSWYSNVLYLGNEGELPILTMTCPASDIERFKS
GELPLAPPSETYAATLIRGLVEGKQLDADGAANYINACAAKGL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgccggcgccggctccggctcccccaatggccgcgccgcgggtggggttgctg
tacgacgatcggatgcgcgcgcacgcgacgcctgacggggaggaacacccggagaacccc
gagcggctgcgcgccatctggcgcaagctcaacgccgagggcgtcgcgcccaggtgtgtg
gcccttaaggcgaaggaagccgaggacaaatatatagcttctgttcacagcaagagccat
ataaagctgatgaaggagattagctcaaagaagtatgatgccaccaggaacaagattgct
aggaaattcaattccatttacttcaacaagggttcctcggaatctgctgttcttgcagct
ggttctgtcatagaggtagctgagaaagttgctgcaggtgagttaagttctgctattgct
ctagtcagacctccaggccaccatgcagaacatgatgaggcaatgggattttgcctcttc
aacaatgtggcagttgcagctaattatctcttaaacgagaggcctgatttaggtatcaag
aagatattgattgtcgattgggatgttcaccatggaaatggcacgcagaaaatgttctac
aatgatcctcgtgtattgttcttctcagttcacagatttgattatggaagcttctatcct
gctgaaggggatgcttctcattgtttcatcggggaagaaggtggtaaagggtataacatc
aatgttccctgggagcatgggaagtgtggggatgctgattatattgctgcatgggaccat
gtactgcttcctgtcactaaagtttttgatcctgatataatactggtatcggctgggttt
gatgcagcattgggtgatcctctcggtgggtgctgcattacaccaaatggatatgcactg
ctactaacaaagttgttaggatttgctcaaggaaggatagtgatggcccttgaaggaggt
tataaccttaggtccatagcaaattcagtttgtgcttgtgcaaaagttctcttgggagac
aaattcacattcaacgctccagagatgcagccatttgaatctacatggagtgttatacaa
gcggtacgtaatgaattgaagacatgctggcctgttctgagtagcaagctgccagaaaat
gtatcattgaggattaggccttcaccaagcgaggtcaacgcttcctctgattccgaatct
gatagtgaagatgttgctgagctccttcccactgttgcatctgtcaatgttattgaagtt
gctggtgatgctataagtgaacacctctcaaagatgaaacttgatgatgacaacctttca
gtgaagactacctcaagttgctcagcagcagaacagcatctagttgattcagtaaaagta
caaaacaatgcatctgtggtgctgaccaaaaaaatatctgatttatctctcgcttggcga
tcagatttatcaagaactgatgtctggtatgccagttttggttcaaacatgtggagacca
agatttctatgctatgttcaaggagggaaggctgagggtatgagtatagcgtgctacgga
tcacgtgatacaagctcaccaaaaggaaccatgtggaagactgtacctcacaggttgctt
tttggtagatcgtctaccccttgttggggaactggtggtgttgcttttctcaaccctgag
ataaactacaatgagaagtcgtatgtctgcatgtacaaaataacgttggagcagttcaat
gacatcttgtttcaggagaatcgtttagtgctgaaggatggcaaagacgggaacgttgtg
tatcctgactctcctttgattggttcatctgaaatcaagtttatatctacaaacaaagct
attcatcttgaacctattaaggatagctggtactccaatgtactttatcttgggaatgag
ggtgaacttccaattctaactatgacgtgccccgcatcagatattgagaggttcaaatct
ggtgagctgcctttagcacctccatcagagacatatgcggccactctgataaggggacta
gttgaaggaaagcaactggatgcggacggagctgccaactacatcaatgcttgtgctgca
aaaggcctgtga

DBGET integrated database retrieval system