KEGG   Sorghum bicolor (sorghum): SORBI_02g039960Help
Entry
SORBI_02g039960   CDS       T01086                                 

Gene name
SORBIDRAFT_02g039960, Sb02g039960
Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SORBI_02g039960 (SORBIDRAFT_02g039960)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 443 aa AA seqDB search
MGSMEASTAPENGSAAGGGAGGTACNGAGASSNGGGMERRLRSSAASASWAAHLPLEVGT
RVMCRWRDQKLHPVKVIERRKGSASSSPADYEYYVHYTEFNRRLDEWVKLEQLDLDTVET
DVDEKVEDKATSLKMTRHQKRKIDETHVEQGHEELDAASLREHEEFTKVKNIAKIELGRY
EIDTWYFSPFPPEYNDCPKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTLS
MFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKH
SEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTR
VLLEILKKHKGNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLK
AAGRGGLDVDVSKLIWTPYKEQG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgggctccatggaagcgtcgaccgcaccggagaatggctccgccgccggtggcggagcc
gggggcacggcgtgcaacggggccggcgcctcgtcgaacggaggaggcatggagaggagg
ctgaggtcctcggctgcgtcggcgtcgtgggcggcgcaccttcccctggaggtgggcacg
cgcgtgatgtgccggtggcgcgaccagaagctccacccggtcaaggtcatcgagcgccgc
aagggctccgcttcctcttcccccgccgactacgagtactacgtccactacaccgagttc
aatagaagactcgatgagtgggttaagcttgagcagcttgatcttgatactgtcgagacc
gatgtggatgagaaagtagaagataaggcaacaagcttaaagatgacacggcaccagaaa
cgtaaaattgatgaaacacatgtggagcaaggacatgaggagcttgatgcagccagcttg
cgggaacatgaagaattcacaaaggtgaaaaatattgcaaagattgaacttgggagatat
gagatagatacatggtatttctctccttttccaccagagtacaatgactgcccgaagctg
tttttctgtgaattttgcctcaacttcatgaagcgcaaagaacaacttcagaggcacatg
aagaagtgtgatcttaagcaccccccaggtgatgaaatctatagaagtggaactctgtct
atgttcgaggttgatgggaagaagaacaaggtttatggacagaatctttgttatctggcc
aagctttttcttgatcacaagacattgtactatgatgttgatttgttcttgttttatgtc
ctctgtgaatgtgatgatcggggatgtcatatggtgggatatttctctaaggaaaaacac
tctgaagaatcttataatttagcttgcattcttactctccccccataccaaagaaaagga
tatgggaagttcctgattgctttctcatatgaactttccaagaaggaaggtaaagttggg
acaccggagcgccctctttctgaccttggtctgctcagctatagaggttattggactaga
gtgcttctagaaattctaaagaaacataagggcaacatatctataaaggaactgagcgac
atgacggcgataaaagcagatgacatcttgagcacgctgcagagcctcgacctaatccag
taccgcaaagggcagcacgtcatctgtgctgacccgaaggtcctcgaccgccacctcaag
gcggcaggccggggcggcctggacgtcgacgttagcaagctgatctggactccctacaag
gagcaaggctaa

DBGET integrated database retrieval system