KEGG   Sorghum bicolor (sorghum): SORBI_02g040000Help
Entry
SORBI_02g040000   CDS       T01086                                 

Gene name
SORBIDRAFT_02g040000, Sb02g040000
Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SORBI_02g040000 (SORBIDRAFT_02g040000)
Enzymes [BR:sbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SORBI_02g040000 (SORBIDRAFT_02g040000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 590 aa AA seqDB search
MVLARVLTLPLPAPSSAPHRRLLLPPQASPAPARVRTVRAAACRAANAMAAVSVDPPPVA
PSPAEVAAVGVGDELPEGYDQMMPTVEPSRRRRAGVLLHPTSLRGPHGIGDLGDEALAFL
HWLRDAGCTLWQVLPLVPPGRTAGEEGSPYSGQDANCGNTLLLSLEELVKDGLLMSDELP
DPVDTEYVEFDTVANLKEPLIAKAAERLLLSHGELRTQYDCFKKNPNISGWLEDAALFAA
IDKSIGAFSWYEWPEPLKNRHLGALEDIYQKQKDFIETFMAQQFLFQRQWQRVRKYAQKL
GISIMGDMPIYVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPLYDWK
AMEADGFSWWTKRIKRALDLYDEFRIDHFRGLAGFWAVPSDAKVALVGSWRAGPRNSFFD
ALFKAVGRINIIAEDLGVITEDVVQLRKSIGAPGMAVLQFAFGGGSDNPHLPHNHEMDQV
VYTGTHDNDTVLGWWQNLPEEEKKIVIKYLPEAENTDISWTLITAALSSVARTSMVTMQD
ILGLDSSARMNTPATQKGNWRRRMPGSVGFDSLSPEAAKLKELLALYNRQ
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgcgcgagtcctcacgctcccgctgcccgccccgtcgtccgcgccccaccgc
cgcttactcctgccgcctcaggcgtcgccggcgcctgcgcgtgtgcgcaccgtgcgggcc
gccgcctgccgtgcagcgaacgccatggcggcggtttctgtggacccgcccccggtcgct
ccgagccccgcagaggtcgcggccgtgggcgtcggggatgagctgccggaggggtacgat
cagatgatgcccaccgtggagccgtcgcggcggcggcgcgcgggggtgctgctgcatccg
acgtcgttgcggggaccgcacggcatcggcgacctcggggacgaggcgcttgccttcctg
cattggctccgcgacgccggctgcacgctctggcaggttctaccacttgtccctccaggt
aggacggctggggaggagggatctccttattctggacaggatgccaactgtggcaatacc
cttttgctatctcttgaggagcttgtaaaagatggtctattgatgtcagatgaacttcct
gatcctgtggatacagagtatgttgaatttgacactgttgcaaatctgaaagaaccactt
attgcaaaggcagcagagaggctcctactaagccatggagagctcagaacgcaatatgac
tgcttcaagaaaaatccaaatatatcaggttggcttgaagatgcagctctttttgctgct
attgacaaaagcattggtgcattctcttggtacgagtggcctgaacctctgaaaaatcgc
catcttggagccttggaagatatatatcaaaaacagaaggactttatagagacatttatg
gctcagcagttcttatttcaaaggcaatggcagcgggttcgtaaatatgcacaaaagctg
ggtatcagcatcatgggtgacatgcctatatatgttggctaccatagtgcagatgtttgg
gcgaacaggaaatcatttttgctggacaagaatggtttccccactttcgttagtggtgtt
ccacctgatgcatttagcgaaacgggtcaactatggaacagtccattgtacgactggaaa
gctatggaagcagatggcttttcatggtggacaaagaggattaaacgtgcccttgatttg
tatgatgagttccgtattgaccatttccggggtcttgcaggtttttgggcagtcccttct
gatgcaaaagtagcactggttggaagctggagggctggaccaaggaatagcttttttgac
gcgctcttcaaagctgttggtagaataaatataatagcagaagacctgggggtaattact
gaagatgttgttcagctaaggaaatccattggggcccctgggatggcagttctccagttt
gcttttggaggtggttctgacaaccctcacttgccccataaccatgaaatggatcaagtt
gtgtacactggaacacatgataacgatacagttcttggctggtggcaaaatttgccagag
gaagagaagaaaattgtgatcaagtatctaccagaagccgagaatactgacatatcatgg
acactgattacggctgccctctcttctgttgcgaggacttccatggtaaccatgcaggac
attcttggcctcgacagttctgctcgaatgaatacgccagctacccagaaaggaaattgg
aggaggaggatgccaggctcagttggcttcgacagtctcagccctgaagcggcaaagctg
aaggagctgcttgcgctgtacaatcggcagtga

DBGET integrated database retrieval system