KEGG   Sorghum bicolor (sorghum): SORBI_02g042960Help
Entry
SORBI_02g042960   CDS       T01086                                 

Gene name
SORBIDRAFT_02g042960, Sb02g042960
Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SORBI_02g042960 (SORBIDRAFT_02g042960)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SORBI_02g042960 (SORBIDRAFT_02g042960)
   00600 Sphingolipid metabolism
    SORBI_02g042960 (SORBIDRAFT_02g042960)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    SORBI_02g042960 (SORBIDRAFT_02g042960)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SORBI_02g042960 (SORBIDRAFT_02g042960)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 431 aa AA seqDB search
MEAPARLPISLLVVSALLLLLSAQGPAGAAAAAVPPRIQPLATAALRRLYDTSNYGRLQL
NNGLALTPQMGWNSWNFFACNINETVIRETADALVSTGLAALGYNFVNIDDCWSYVKRGK
QDQLLPDPKTFPSGIKALADYVHGKGLKLGIYSDAGKFTCQVRPGSLDHESDDAAIFASW
GVDYLKYDNCYNLGIKPQKRYPPMRDALNSTGRQIFYSLCEWGQDDPALWAGKVGNSWRT
TDDITDTWQSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMTSAEYRSHFSIWALMKA
PLLIGCDVRNMTSETMEILSNKEVIQVNQDPLGVQGRKILGEGKYGCREVWAGPLSGNRL
VIALWNRCSETANITMKLPAVGLDGSAAYSVRDLWKHETLSENVVGTFGAQVDVHDTKMY
IFSPATSVASI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgccggctcgcctccccatctccctcctcgtcgtctccgccctcctcctcctc
ctctcggctcagggaccggcgggagcggcggcggcggccgtgccgccgcgaatccagccg
ctcgctaccgccgcgctgcgccgcctctacgacacctccaactacggcaggctgcagctc
aacaacggcctcgcgctcactccgcagatggggtggaacagctggaatttcttcgcttgc
aacatcaatgagacggtcatccgcgagacagctgacgcgctggtgtccacgggactggct
gctctgggctacaacttcgtaaatattgatgattgctggtcatacgtgaaacgaggaaag
caggaccaattgctgcctgatccgaagactttcccttcaggcatcaaagcccttgcagat
tatgtgcatggaaaaggtctgaaacttggtatatactctgatgctgggaaatttacttgc
caagttcgacctggatcactcgatcatgaaagtgacgatgctgcgatctttgcttcatgg
ggtgttgattacctgaagtatgacaactgctacaatttgggaataaagccacagaaaaga
tatcctcctatgcgagatgctcttaactcaactgggcgccaaatcttctactctttgtgt
gaatggggccaggatgatccagccttatgggctggcaaagtgggcaatagttggcgtaca
actgatgacataacggatacatggcaaagcatgacagacattgctgataagaacaacaag
tgggcgtcatatgctggacctggtggttggaatgacccagatatgttggaagtaggcaat
ggtggcatgacctcagcagagtatcgctcacattttagcatctgggctctcatgaaggcc
cctttattaattggctgtgatgtcagaaacatgacttctgaaacaatggaaatattgagc
aacaaagaagtaattcaagtaaaccaagatcctcttggagttcaaggaagaaaaatttta
ggagaaggaaaatatggatgccgtgaggtgtgggctggtcccctgtctggaaatcggctt
gttattgctctatggaaccgttgttctgagactgctaatattacaatgaaactgccagcg
gtaggccttgatggatcagctgcctattctgttagggatctgtggaagcatgaaacgcta
tcagaaaatgtggtaggaacttttggcgctcaagttgacgtgcatgacaccaagatgtac
atcttttctcctgcaaccagtgtcgcttcaatttga

DBGET integrated database retrieval system