KEGG   Sorghum bicolor (sorghum): SORBI_02g042960Help
Entry
SORBI_02g042960   CDS       T01086                                 

Gene name
SORBIDRAFT_02g042960, Sb02g042960
Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sbi00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:sbi00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 431 aa AA seqDB search
MEAPARLPISLLVVSALLLLLSAQGPAGAAAAAVPPRIQPLATAALRRLYDTSNYGRLQL
NNGLALTPQMGWNSWNFFACNINETVIRETADALVSTGLAALGYNFVNIDDCWSYVKRGK
QDQLLPDPKTFPSGIKALADYVHGKGLKLGIYSDAGKFTCQVRPGSLDHESDDAAIFASW
GVDYLKYDNCYNLGIKPQKRYPPMRDALNSTGRQIFYSLCEWGQDDPALWAGKVGNSWRT
TDDITDTWQSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMTSAEYRSHFSIWALMKA
PLLIGCDVRNMTSETMEILSNKEVIQVNQDPLGVQGRKILGEGKYGCREVWAGPLSGNRL
VIALWNRCSETANITMKLPAVGLDGSAAYSVRDLWKHETLSENVVGTFGAQVDVHDTKMY
IFSPATSVASI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgccggctcgcctccccatctccctcctcgtcgtctccgccctcctcctcctc
ctctcggctcagggaccggcgggagcggcggcggcggccgtgccgccgcgaatccagccg
ctcgctaccgccgcgctgcgccgcctctacgacacctccaactacggcaggctgcagctc
aacaacggcctcgcgctcactccgcagatggggtggaacagctggaatttcttcgcttgc
aacatcaatgagacggtcatccgcgagacagctgacgcgctggtgtccacgggactggct
gctctgggctacaacttcgtaaatattgatgattgctggtcatacgtgaaacgaggaaag
caggaccaattgctgcctgatccgaagactttcccttcaggcatcaaagcccttgcagat
tatgtgcatggaaaaggtctgaaacttggtatatactctgatgctgggaaatttacttgc
caagttcgacctggatcactcgatcatgaaagtgacgatgctgcgatctttgcttcatgg
ggtgttgattacctgaagtatgacaactgctacaatttgggaataaagccacagaaaaga
tatcctcctatgcgagatgctcttaactcaactgggcgccaaatcttctactctttgtgt
gaatggggccaggatgatccagccttatgggctggcaaagtgggcaatagttggcgtaca
actgatgacataacggatacatggcaaagcatgacagacattgctgataagaacaacaag
tgggcgtcatatgctggacctggtggttggaatgacccagatatgttggaagtaggcaat
ggtggcatgacctcagcagagtatcgctcacattttagcatctgggctctcatgaaggcc
cctttattaattggctgtgatgtcagaaacatgacttctgaaacaatggaaatattgagc
aacaaagaagtaattcaagtaaaccaagatcctcttggagttcaaggaagaaaaatttta
ggagaaggaaaatatggatgccgtgaggtgtgggctggtcccctgtctggaaatcggctt
gttattgctctatggaaccgttgttctgagactgctaatattacaatgaaactgccagcg
gtaggccttgatggatcagctgcctattctgttagggatctgtggaagcatgaaacgcta
tcagaaaatgtggtaggaacttttggcgctcaagttgacgtgcatgacaccaagatgtac
atcttttctcctgcaaccagtgtcgcttcaatttga

DBGET integrated database retrieval system