KEGG   Sorghum bicolor (sorghum): SORBI_03g003630Help
Entry
SORBI_03g003630   CDS       T01086                                 

Gene name
SORBIDRAFT_03g003630, Sb03g003630
Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sbi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 360 aa AA seqDB search
MAAVDPPPRGEAAPAPAPVLKRSTSIDRIPEDARRILHRLAGDLWGSDVDPSALTVSQLK
GAMTNEVFRITWPGGEGDPRKVLVRIYGRGVEVFFDRADEVRTFECMSRHGQGPRLLGRF
ANGRVEEFIYARTLSAADLRDPEISALIAKKLREFHDLDMPGPRDVSLWQRLRRWLEEAR
GRCSEQEFNQFQLDKLGDEIAVLEKTLSGVEQSVGFCHNDLQYGNIMIDEETRQVTLIDY
EYASFNPIAFDIANHFCEMAADYHTATPHELDFTKYPGIEEQRRFVQTYLCSAGEKPSDG
EVEKLLGLIAKYTPASHLFWGLWGIISAHVNNNIDFEYKEYARQRLDQYWQTKPGMLGPN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtggacccgccgccgcgcggcgaggccgcgcccgcgcccgcgcccgtgctg
aagcggagcaccagcatcgaccggatccctgaggacgcgcgccgcatcctgcaccgcctc
gccggcgacctctggggcagcgacgtggaccccagcgcgctcaccgtgtcccagctcaag
ggcgccatgaccaacgaggtcttccggatcacctggcccggcggcgagggcgacccgcgc
aaggtgctcgtgcgcatctacggccgcggcgtcgaggtcttcttcgaccgcgccgacgag
gtccgcaccttcgagtgcatgtcgcgccacggccaggggccccgcctcctcggccgcttt
gccaacggccgcgtcgaggagttcatctacgccaggacgctctctgcggcggatctgcgc
gacccggagatatccgcgctgattgccaagaagctgcgggagtttcacgatctcgacatg
cctggacctagggatgtgtcattgtggcagaggctcaggaggtggcttgaggaggctcgt
ggcaggtgttctgagcaagagtttaaccaatttcagctggataagctaggcgatgagatt
gcagtgctggagaagacgctctcgggggtcgaacagtccgtaggattttgccataatgat
ttgcagtatgggaatattatgatagatgaagagaccagacaagtcaccttgattgactat
gaatatgcgagttttaacccaatcgcatttgacattgctaatcacttttgtgagatggct
gctgattaccatacagcaacaccacacgagttggattttacaaaatatcctggcattgag
gaacagagaagatttgttcagacatacctttgctctgcaggtgaaaagccatcagatggg
gaagttgaaaaactactagggttgattgcaaagtacactcctgcaagccatctcttttgg
ggcctgtggggaataatctcggcacatgtaaacaataatatcgacttcgagtacaaggaa
tatgcaaggcaacgcttggatcagtactggcaaacaaagcctggaatgcttgggcccaac
tga

DBGET integrated database retrieval system