KEGG   Sorghum bicolor (sorghum): SORBI_03g004040Help
Entry
SORBI_03g004040   CDS       T01086                                 

Gene name
SORBIDRAFT_03g004040, Sb03g004040
Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SORBI_03g004040 (SORBIDRAFT_03g004040)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SORBI_03g004040 (SORBIDRAFT_03g004040)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SORBI_03g004040 (SORBIDRAFT_03g004040)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 795 aa AA seqDB search
MDLLRSHLHKVRIPEPTNRIHKDECCVSFDTPRSEGGLYVDMSSFLGFGREYVEWNFEKT
GNPVYLHIVQRRKPEPDEADRPLKKPTLLAIGVEGGFGDQEPEYDDTFEIVILPDFVSLP
FPSVDLPEKVRLAVDKVLLAESADRKEQLAAWVADKKNISAYAMDLQQLDNGVVVPPTGW
KCSKCDKTENLWMNLTDGMILCGRKLWDGSGGNNHAIEHYEQTKYPLAVKLGTITADLEA
ADVFSYPEDDSVEDPLLAQHLSHFGIDFSSLQKTEMTTAERELDANTNYDWNRIQESGKD
AELLFGPGYTGLANLGNSCYMASIMQVMFSTHPFISRYFEKQSLKAAFATAPADPTVDLN
MQMTKLGHGLLSGKYSAPAKEGQEGIRPRMFKSVIAANHPEFSSMRQQDALDFFLHLIDR
VEKANPGNHELNPCSGFKFIVEERVQCPSGKVSYNKRSDYILSLSIPLHEATNKEQLEAF
NEKKAAMDLDGKEVSNEDIVRPRVPLEACLASFSGPEEIPDFYSTALNSKTTATKTAGFN
TFPDYLVLHMRKFVMEAGWVPKKLDVYIDVPDTIDITHMRSKGVQPGEELLPEGGSGDNS
AEPAHPVASEDIVSQLASMGFNYLHCQKAAINTSNTGVEEAMNWLLSHMDDPDINDPISK
DSRASEPSVDEASVQTLISFGFQEDVAIKALKASGGNIEKATDWIFSHPEASSSASADSS
TSNANADDAYIPDGSGRYKLMAFVSHMGTSTHCGHYVAHVLKDGRWTIFNDSKVAASVDL
PKEMGYLYFFQRISN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctgcgttctcatctccacaaggtccggatcccggagcccaccaaccgcatc
cacaaggacgagtgctgcgtctccttcgacaccccgaggtcagagggaggcctgtatgtg
gacatgagctcgttcctgggcttcgggagggagtacgtggagtggaacttcgagaagacg
gggaaccccgtgtacctccacatcgtgcagcgccggaagccggagcccgacgaggcggat
cgcccgcttaagaagcccaccctcctcgctataggtgtggaaggaggttttggtgatcaa
gaaccagaatatgatgatacttttgaaattgtcatcttacctgattttgtctctcttcca
tttccatcagttgatttgccagagaaggttaggcttgcggttgataaagttttacttgct
gaaagtgctgataggaaagaacaattggctgcttgggttgctgacaagaagaacattagt
gcatatgctatggacctgcaacagctagacaatggtgttgttgtgcctcctactggatgg
aagtgtagcaaatgcgataaaactgagaacctctggatgaatttaactgatggtatgatc
ctttgtgggaggaagctttgggatgggagtggtgggaataatcatgccattgaacactat
gaacagactaaataccctcttgcggtaaagcttgggacaattactgctgatctggaagca
gcagatgttttctcataccctgaagatgatagcgttgaagatccactattagctcagcac
ttatcacatttcggtatcgatttttcttcacttcaaaagactgagatgactactgctgag
agagaacttgatgccaacactaattatgactggaatagaatacaagaaagtggaaaagat
gctgaacttttgtttggacctggctatacaggtcttgcgaatcttgggaatagttgctat
atggcttctataatgcaagtcatgttttcaacccatcctttcatatcaagatactttgag
aaacagagtttgaaagctgcatttgcaactgctccagctgatccaacagtagacctaaac
atgcaaatgacaaaactaggacatggtttgctctctggtaaatattctgcaccagcaaag
gaggggcaggaagggatacgtcctcgcatgtttaagtcagttattgccgcgaaccatcct
gaattttctagcatgagacaacaggatgccctcgacttcttcctccaccttattgacaga
gttgagaaggcaaaccctgggaaccatgagctaaatccttgttccggtttcaagttcatt
gttgaagagagggtccagtgcccttctgggaaagtttcctacaacaaacggtctgactat
attctttctttgagcataccactgcatgaggcaacaaataaagagcagctagaagctttt
aatgagaagaaagctgcaatggacttggatggaaaagaagtgtctaatgaggatattgtc
aggcctagagtcccattggaggcttgcttagcgagtttttcagggccagaggaaatcccg
gatttttatagcactgcattaaattcgaagactaccgccactaagactgctggtttcaac
acctttcctgattaccttgtgttgcacatgcgcaagtttgtaatggaagcaggatgggtg
ccaaagaaactcgatgtttatatagatgtgccagatacgattgatatcacacatatgcgc
agcaaaggtgtacagcctggggaagagctactacctgaaggaggttctggtgacaacagt
gctgagcctgctcaccctgttgccagtgaggatattgtgtcccaacttgcaagcatgggc
ttcaactaccttcattgtcagaaagctgctattaacacatcaaacacaggagttgaggag
gcgatgaattggctcctctctcacatggatgatccagatataaatgacccaatatcaaaa
gattcacgtgcttctgagccgtctgttgatgaagcaagtgttcaaactctcatttccttt
ggatttcaggaagatgttgccataaaggccctgaaagcttctggcggtaatattgagaaa
gcaaccgactggattttcagccaccccgaagcatcgagctcagcatctgctgattcttcc
actagcaatgcaaatgctgatgacgcatacattccagatggaagtggcagatacaagctg
atggcgtttgtgagccatatgggcacctctacccactgcgggcactacgtagctcatgtc
ctcaaagacgggaggtggacaatcttcaacgacagcaaggtcgcagcatcagttgacctg
cccaaggaaatgggctacctctatttctttcagaggattagcaactag

DBGET integrated database retrieval system