KEGG   Sorghum bicolor (sorghum): SORBI_03g005720Help
Entry
SORBI_03g005720   CDS       T01086                                 

Gene name
SORBIDRAFT_03g005720, Sb03g005720
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SORBI_03g005720 (SORBIDRAFT_03g005720)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 149 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKAPAGKKPKAEKRLPAGKSAGKEGGDKKGKKKAKKSVE
TYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGEAAKLARYNKKPTITSREIQ
TSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggcggcgaagaagcccgcggaggaggagcccgcg
gccgagaaggccccggcggggaagaagcccaaggcggagaagcgcctccccgcgggcaag
tctgccggcaaggagggcggcgacaagaagggcaagaagaaggccaagaagtcggtggag
acctacaagatctacatcttcaaggtgctcaagcaggtgcaccccgacatcggcatctcc
tccaaggccatgtccatcatgaactccttcatcaacgacatcttcgagaagctcgccggc
gaggccgccaagctcgcccgctacaacaagaagcccaccatcacctccagggagatccag
acgtcggtgcgcctcgtcctcccaggcgagctcgccaagcacgccgtgtccgagggcacc
aaggccgttaccaagttcacctcatcttag

DBGET integrated database retrieval system