KEGG   Sorghum bicolor (sorghum): SORBI_03g006130Help
Entry
SORBI_03g006130   CDS       T01086                                 

Gene name
SORBIDRAFT_03g006130, Sb03g006130
Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_03g006130 (SORBIDRAFT_03g006130)
   01230 Biosynthesis of amino acids
    SORBI_03g006130 (SORBIDRAFT_03g006130)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_03g006130 (SORBIDRAFT_03g006130)
   00051 Fructose and mannose metabolism
    SORBI_03g006130 (SORBIDRAFT_03g006130)
   00562 Inositol phosphate metabolism
    SORBI_03g006130 (SORBIDRAFT_03g006130)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SORBI_03g006130 (SORBIDRAFT_03g006130)
Enzymes [BR:sbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SORBI_03g006130 (SORBIDRAFT_03g006130)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SORBI_03g006130 (SORBIDRAFT_03g006130)
  Exosomal proteins of bladder cancer cells
   SORBI_03g006130 (SORBIDRAFT_03g006130)
  Exosomal proteins of melanoma cells
   SORBI_03g006130 (SORBIDRAFT_03g006130)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 253 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVEKIVKTLNEGQVPPADVVEVVVSPPYVFLTVVKSLLRPEF
HVAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRALLGESNEFVGDKVAYALSQ
GLKVIACVGETLEQREAGSTMEVVAAQTKAIAEKISDWSNVVVAYEPVWAIGTGKVATPA
QAQEVHASLRDWLKINVSPEVAESTRIIYGGSVTAANCKELGAQPDVDGFLVGGASLKPE
FIDIINAATVKSA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgtcggcggcaactggaaatgcaacggaaccacagatcaggtc
gagaagattgtcaaaaccctgaatgaaggacaggttccccctgcagatgttgttgaggtc
gttgtcagccctccttatgtcttcctaactgtggtcaagagcctgctgcgcccagagttc
catgttgctgctcagaactgctgggtgaagaagggaggtgctttcactggtgaagtcagt
gctgagatgctcgtcaaccttggtgttccctgggtcatccttggacactctgaaaggaga
gctctgctgggagaatcaaatgagtttgttggagacaaggttgcttatgcgctgtctcag
ggactaaaggtcattgcatgtgttggtgagacccttgagcagagggaggctgggtcaaca
atggaagttgttgctgcacaaacaaaagcaattgctgagaagatcagtgactggagcaac
gtagttgttgcctatgaaccagtatgggccattggaactggtaaagttgccaccccagct
caggctcaggaagtgcacgcatccctgagggattggctaaagatcaacgtcagccctgag
gttgctgaatctacaaggatcatctacggaggttctgtaactgcagcgaactgcaaagag
ctaggagcacagcctgatgtcgatggtttccttgtcggtggagcttctttgaagcccgag
ttcatcgacatcatcaacgcggccaccgtgaagtccgcttaa

DBGET integrated database retrieval system