KEGG   Sorghum bicolor (sorghum): SORBI_03g006130Help
Entry
SORBI_03g006130   CDS       T01086                                 

Gene name
SORBIDRAFT_03g006130, Sb03g006130
Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:sbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sbi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:sbi00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:sbi00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 253 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVEKIVKTLNEGQVPPADVVEVVVSPPYVFLTVVKSLLRPEF
HVAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRALLGESNEFVGDKVAYALSQ
GLKVIACVGETLEQREAGSTMEVVAAQTKAIAEKISDWSNVVVAYEPVWAIGTGKVATPA
QAQEVHASLRDWLKINVSPEVAESTRIIYGGSVTAANCKELGAQPDVDGFLVGGASLKPE
FIDIINAATVKSA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgtcggcggcaactggaaatgcaacggaaccacagatcaggtc
gagaagattgtcaaaaccctgaatgaaggacaggttccccctgcagatgttgttgaggtc
gttgtcagccctccttatgtcttcctaactgtggtcaagagcctgctgcgcccagagttc
catgttgctgctcagaactgctgggtgaagaagggaggtgctttcactggtgaagtcagt
gctgagatgctcgtcaaccttggtgttccctgggtcatccttggacactctgaaaggaga
gctctgctgggagaatcaaatgagtttgttggagacaaggttgcttatgcgctgtctcag
ggactaaaggtcattgcatgtgttggtgagacccttgagcagagggaggctgggtcaaca
atggaagttgttgctgcacaaacaaaagcaattgctgagaagatcagtgactggagcaac
gtagttgttgcctatgaaccagtatgggccattggaactggtaaagttgccaccccagct
caggctcaggaagtgcacgcatccctgagggattggctaaagatcaacgtcagccctgag
gttgctgaatctacaaggatcatctacggaggttctgtaactgcagcgaactgcaaagag
ctaggagcacagcctgatgtcgatggtttccttgtcggtggagcttctttgaagcccgag
ttcatcgacatcatcaacgcggccaccgtgaagtccgcttaa

DBGET integrated database retrieval system